BYKdb

Annotate results for A0A127EZW8

A0A127EZW8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A127EZW8
DOMAINtad43/225LSELIDWVIGIARRRYAIIAAAFVAVVGLGFVILFTSPAYYTSHARLLIDTGFARAAQTQ
GQQILGDYQIDSAQVDTQIELLKSDKIALSVVKDMKLAEKPEFTGTQKGFVRTLLGMIAE
PIFSGSAGTKEVASEQQLTDMALGRVLSQRAVSRVGRTYVLDIAYTSLDPAQAGAVANGI
ADA
DOMAINcd595/785TSSVPNEGKSTASANLAELIANSGNRVLLIDGDLRNPTLSRQMLKSAEVGILEVLGRKVD
LRQAVHTDEQTGLDFLPVVIQSHLAHSSDILASEAFRSFIEGLRTMYDYIIIDLSPMMPV
VDVRATTKFVDTYVYVVEWGRTKINVVQRQFNSAPEVVERLLGVLLNKANFKVMDRYTGD
YGGDYYKSYYS
SITEWalker A602/604GKS
SITEWalker A'622/629LLIDGDLR
SITEWalker B704/710IIIDLSP
SITE-701/-729YDYIIIDLSPMMPVVDVRATTKFVDTYVY
SITEY Cluster771/787YTGDYGGDYYKSYYSRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALGDVVAIYRLTAGGLVMMDSYKQIPIVEQREQGLAAGSLNLSELIDWVIGIARRRYAIIAAAFVAVVGLGFVILFTSP
                                          LSELIDWVIGIARRRYAIIAAAFVAVVGLGFVILFTSP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYYTSHARLLIDTGFARAAQTQGQQILGDYQIDSAQVDTQIELLKSDKIALSVVKDMKLAEKPEFTGTQKGFVRTLLGMI
AYYTSHARLLIDTGFARAAQTQGQQILGDYQIDSAQVDTQIELLKSDKIALSVVKDMKLAEKPEFTGTQKGFVRTLLGMI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEPIFSGSAGTKEVASEQQLTDMALGRVLSQRAVSRVGRTYVLDIAYTSLDPAQAGAVANGIADAYILDMLDSKFQATRR
AEPIFSGSAGTKEVASEQQLTDMALGRVLSQRAVSRVGRTYVLDIAYTSLDPAQAGAVANGIADA               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASKWLQDRIAELRQQALTADQKVLAFKEEKKIVEMGGANSRLLGDQQVADISTQLGQARAAMAEASARLERIQQVMKQDI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDAAVADSLHSGIITQLRTQYLDYDRKYQLWSSRYGPDHLAAINIKTQMNYLRDSMRNELGRIGESYKSDLAIAGARVEA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQASLTTLISSAQSTNRERLGLQELETSAKVYHSIYDNFLQRFMEMSQQLSFPVTEARVISPAGDGGKTSPKSGRIMTYA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLLGLMLGLGLAMFKEAMDRVFRTADQVESILGTNCLAVVPVIKSSGPAKIRSQSPNKPAKLGAGTQQMLASNMDSTLRH


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVDEPLLPFAEAFRSVKVAVDISRAIKENKVIGITSSVPNEGKSTASANLAELIANSGNRVLLIDGDLRNPTLSRQMLKS
                                  TSSVPNEGKSTASANLAELIANSGNRVLLIDGDLRNPTLSRQMLKS
                                         GKS                 LLIDGDLR           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEVGILEVLGRKVDLRQAVHTDEQTGLDFLPVVIQSHLAHSSDILASEAFRSFIEGLRTMYDYIIIDLSPMMPVVDVRAT
AEVGILEVLGRKVDLRQAVHTDEQTGLDFLPVVIQSHLAHSSDILASEAFRSFIEGLRTMYDYIIIDLSPMMPVVDVRAT
                                                               IIIDLSP          
       730       740       750       760       770       780       790  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
TKFVDTYVYVVEWGRTKINVVQRQFNSAPEVVERLLGVLLNKANFKVMDRYTGDYGGDYYKSYYSRYGARPN
TKFVDTYVYVVEWGRTKINVVQRQFNSAPEVVERLLGVLLNKANFKVMDRYTGDYGGDYYKSYYS       
                                                  YTGDYGGDYYKSYYSRY     

© 1998-2019