BYKdb

Annotate results for A0A127GM79

A0A127GM79 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A127GM79
DOMAINtad1/174MIPNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKLGELAI
SWMHIPQLNGQDQQLTLTVGENGHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGT
QFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQLITRILNSIANN
DOMAINcd459/648TGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDE
LNKVIQHFGKGDFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSN
AAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYN
YYGYSYSEKE
SITEWalker A466/468GKT
SITEWalker A'486/493LFIDADLR
SITEWalker B566/572VIVDTPP
SITEY Cluster633/644YSYGYNYYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIPNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKLGELAISWMHIPQLNGQDQQLTLTVG
MIPNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKLGELAISWMHIPQLNGQDQQLTLTVG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENGHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDD
ENGHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDN
PQLITRILNSIANN                                                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKSSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVSAVLARAMLRRGVEAPEQLEEHGISVYSTIPMSEWLDK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQ
                                                          TGATPDSGKTFVSSTLAAVIAQ
                                                                 GKT            
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGDFDVITRGQVPPNPSELLMRDRMRQLLEWAN
SDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGDFDVITRGQVPPNPSELLMRDRMRQLLEWAN
     LFIDADLR                                                                   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DHYDLVIVDTPPMLAVSNAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYY
DHYDLVIVDTPPMLAVSNAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYY
     VIVDTPP                                                            YSYGYNYY
        
....:...
GYSYSEKE
GYSYSEKE
GYSY    
© 1998-2019