BYKdb

Annotate results for A0A127W2Q4

A0A127W2Q4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A127W2Q4
DOMAINcd52/234TSSTPGEGKSTSASNVAIVFAEEGKKVLLVDADMRKPTMHYTFHKTNSTGLSNLLTRKWE
LKDVVIETEIEGLHIVTSGPIPPNPAELLGSKTMDSLIEEFIAGYDIVVFDAPPLLSVAD
AQILSNKCDGTILVISSGTAEKDSVIKAKEALVSSKANILGTLLNNFVLEKEHHYYQYYG
TGE
SITEWalker A59/61GKS
SITEWalker A'79/86LLVDADMR
SITEWalker B159/165VVFDAPP
SITEY Cluster226/230YYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNKKKKPIQTVARKLVTYDSPKSVVSEQFRTVRTNINFSMPDKDLKTLLFTSSTPGEGKSTSASNVAIVFAEEGKKVLL
                                                   TSSTPGEGKSTSASNVAIVFAEEGKKVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADMRKPTMHYTFHKTNSTGLSNLLTRKWELKDVVIETEIEGLHIVTSGPIPPNPAELLGSKTMDSLIEEFIAGYDIVV
VDADMRKPTMHYTFHKTNSTGLSNLLTRKWELKDVVIETEIEGLHIVTSGPIPPNPAELLGSKTMDSLIEEFIAGYDIVV
VDADMR                                                                        VV
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
FDAPPLLSVADAQILSNKCDGTILVISSGTAEKDSVIKAKEALVSSKANILGTLLNNFVLEKEHHYYQYYGTGE
FDAPPLLSVADAQILSNKCDGTILVISSGTAEKDSVIKAKEALVSSKANILGTLLNNFVLEKEHHYYQYYGTGE
FDAPP                                                            YYQYY    
© 1998-2019