BYKdb

Annotate results for A0A132EQ08

A0A132EQ08 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A132EQ08
DOMAINtad17/276PPHPFRRYWGMLYGGRRMIVGSALICVAAGALYALCARPVYRSDVLFQVEQSPTDTKPAS
PTGDPSSMFDLKTDAATEIEVLKSRAVMARAVDSTKLYIEARPRYVPLIGWRLVNGADGL
SSPLPGGYVYGTERIDVAAFDVPKRLYDRPFALTVGRGGTYTLQRTGLFGRKGPVWEGRI
GEALHAETPDGSIDLLVRGIDGEPGARFDLTRHGEAETTAWLQKNVLISERGKQSDIIGA
TLDGSDAEHISRILNAIGDA
DOMAINcd553/741SGPTTGVGKSYIASNLAALAAAASQRVLLIDADLRKGALHDHFRYSRAPGLSDVVMGTHR
LDEALKRDVRPGLDFLSMGSIVADPGEVLLQPALAELIERLSSQYRMIVIDGSPLLPVTD
GLALGRLAGIVFLVARSGVTTLAEIDESVRRLEDVQVAVRGVILNDFAHGPGQGYGYGNA
ETHQAASGY
SITEWalker A560/562GKS
SITEWalker A'580/587LLIDADLR
SITEWalker B660/666IVIDGSP
SITEY Cluster727/729YGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSHLTLPESRGGPTARPPHPFRRYWGMLYGGRRMIVGSALICVAAGALYALCARPVYRSDVLFQVEQSPTDTKPASPTGD
                PPHPFRRYWGMLYGGRRMIVGSALICVAAGALYALCARPVYRSDVLFQVEQSPTDTKPASPTGD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSSMFDLKTDAATEIEVLKSRAVMARAVDSTKLYIEARPRYVPLIGWRLVNGADGLSSPLPGGYVYGTERIDVAAFDVPK
PSSMFDLKTDAATEIEVLKSRAVMARAVDSTKLYIEARPRYVPLIGWRLVNGADGLSSPLPGGYVYGTERIDVAAFDVPK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLYDRPFALTVGRGGTYTLQRTGLFGRKGPVWEGRIGEALHAETPDGSIDLLVRGIDGEPGARFDLTRHGEAETTAWLQK
RLYDRPFALTVGRGGTYTLQRTGLFGRKGPVWEGRIGEALHAETPDGSIDLLVRGIDGEPGARFDLTRHGEAETTAWLQK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVLISERGKQSDIIGATLDGSDAEHISRILNAIGDAYLAQNTQRKSEAADKLIRFMDAQLPQLKAQLEAAEGRFNAYRAS
NVLISERGKQSDIIGATLDGSDAEHISRILNAIGDA                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HGSVNTSDEALALRQQSVDIETRILTLQQQRQELLTRFMNKHPAVVAVDAQLADAQRSLAAVREQIQKLPAVEQGVLQLQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDVTVDTALYTNLLNARQQMLLARASKTGTVRIVDRAKVADLPVQPHRGVAVAAALVLGVLAAAAYLVLRQRFVGTVSDP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GEIEWTTGLPVIATVPRGESPRLANADARHRPHASSAALRGGPPDPAIESLRNFRTTLQLSLPDAPNRVVLISGPTTGVG
                                                                        SGPTTGVG
                                                                               G
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSYIASNLAALAAAASQRVLLIDADLRKGALHDHFRYSRAPGLSDVVMGTHRLDEALKRDVRPGLDFLSMGSIVADPGEV
KSYIASNLAALAAAASQRVLLIDADLRKGALHDHFRYSRAPGLSDVVMGTHRLDEALKRDVRPGLDFLSMGSIVADPGEV
KS                 LLIDADLR                                                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLQPALAELIERLSSQYRMIVIDGSPLLPVTDGLALGRLAGIVFLVARSGVTTLAEIDESVRRLEDVQVAVRGVILNDFA
LLQPALAELIERLSSQYRMIVIDGSPLLPVTDGLALGRLAGIVFLVARSGVTTLAEIDESVRRLEDVQVAVRGVILNDFA
                   IVIDGSP                                                      
       730       740       750        
....:....|....:....|....:....|....:...
HGPGQGYGYGNAETHQAASGYAGMMTHRPAGAAGKGDR
HGPGQGYGYGNAETHQAASGY                 
      YGY                             

© 1998-2019