BYKdb

Annotate results for A0A132F2F8

A0A132F2F8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A132F2F8
DOMAINtad15/271DEPELVRYVDLVLTNRWLVAGVAAIVFTVGTAYVLLARPVYESNLLIQVEDNTGSADTLL
GSVSSLFDAKIQATAEIEILKSRMVVDHAVKNLRLYIEATPKRFPLVGNAIAARTPGLSR
PGLLGLGGYAWANESIDVGTFDVPKAFEDETFELTALSGGRFRLDNGDLDRPIEGALGQL
VESTQAGGTFRIRVNALQGNPGVVFRVKRRSELKTLQKLQRQLNVSEIRKQSNVINVSLK
GEDPDTVANILNTIGSA
DOMAINcd548/735TGPSPGIGKSFVSANLAAVMAAAGHRVLLVDADMRRGHLNESFDVPSSPGLSDVLAGHVQ
LRGATRRVTDALDFLPAGTPSPRASELLLGESTLRSLDEMSAAYDVVIIDTPPVLAVSDA
TILAPHCATTFLVTRARQTTIGEIAESAKQLNRISSGLLGVLFNGVDTRAFGYRSRYGAY
RYAPYGPV
SITEWalker A555/557GKS
SITEWalker A'575/582LLVDADMR
SITEWalker B654/660VIIDTPP
SITEY Cluster720/732YRSRYGAYRYAPY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNRASGPLPETDLGDEPELVRYVDLVLTNRWLVAGVAAIVFTVGTAYVLLARPVYESNLLIQVEDNTGSADTLLGSVSSL
              DEPELVRYVDLVLTNRWLVAGVAAIVFTVGTAYVLLARPVYESNLLIQVEDNTGSADTLLGSVSSL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDAKIQATAEIEILKSRMVVDHAVKNLRLYIEATPKRFPLVGNAIAARTPGLSRPGLLGLGGYAWANESIDVGTFDVPKA
FDAKIQATAEIEILKSRMVVDHAVKNLRLYIEATPKRFPLVGNAIAARTPGLSRPGLLGLGGYAWANESIDVGTFDVPKA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FEDETFELTALSGGRFRLDNGDLDRPIEGALGQLVESTQAGGTFRIRVNALQGNPGVVFRVKRRSELKTLQKLQRQLNVS
FEDETFELTALSGGRFRLDNGDLDRPIEGALGQLVESTQAGGTFRIRVNALQGNPGVVFRVKRRSELKTLQKLQRQLNVS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIRKQSNVINVSLKGEDPDTVANILNTIGSAYVAQNVKRKSAEAEKSLAFLESVAPQLKQNLERAEAKYNAMRRKRGTFD
EIRKQSNVINVSLKGEDPDTVANILNTIGSA                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGIEAQAYLQDSIATQATLLALQQKRADASTRFAPGHPDMQALDRQIDGAKQKIDGLSARLRAFPDIEQDELRLRRDVEV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNAMYVGVLNNIQQLKLVSAGKVGNVREVDSAPVPEEPVEPRKALILALSTILGAMLGLMAAIAREALFGGVKDADDIER


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTGLTVYGTIPDSSAQRAAEVSAKRHRSIPQLLADENPHDPAIESLKSLRTALGLALLDADNNRVLLTGPSPGIGKSFVS
                                                                   TGPSPGIGKSFVS
                                                                          GKS   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANLAAVMAAAGHRVLLVDADMRRGHLNESFDVPSSPGLSDVLAGHVQLRGATRRVTDALDFLPAGTPSPRASELLLGEST
ANLAAVMAAAGHRVLLVDADMRRGHLNESFDVPSSPGLSDVLAGHVQLRGATRRVTDALDFLPAGTPSPRASELLLGEST
              LLVDADMR                                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRSLDEMSAAYDVVIIDTPPVLAVSDATILAPHCATTFLVTRARQTTIGEIAESAKQLNRISSGLLGVLFNGVDTRAFGY
LRSLDEMSAAYDVVIIDTPPVLAVSDATILAPHCATTFLVTRARQTTIGEIAESAKQLNRISSGLLGVLFNGVDTRAFGY
             VIIDTPP                                                           Y
       730       740       750      
....:....|....:....|....:....|....:.
RSRYGAYRYAPYGPVEPSDGTRPAADRRACAQREAS
RSRYGAYRYAPYGPV                     
RSRYGAYRYAPY                        

© 1998-2019