BYKdb

Annotate results for A0A132F7S1

A0A132F7S1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A132F7S1
DOMAINtad16/274DAVRLADYLVVLTESWRLIAVITAIGVFVGVLYAFLSHPVYRADAMIQVEDNSGSAKDAL
GELASIFDTKATAAAEIELIRSRMVVGEAVSQLHLDIVVQPRYFPIVGAWFARRAGNDGV
AAPMFGLKRFAWGGERIVVSKFDVPDAWNRKTFVLKATADQSYELYDPDGNFVLRGKAGV
EAGGALKDKGVAHLVVERLVARPETEFQLVRNSTLATIDAIQKSLTIDEKTKDSGIIGLK
LDGADNARTTETVNAIARN
DOMAINcd550/737TGSRPEVGKTFISSNLSAVLAATGKRVLLIDADMRRGDVHTYFGLKRRAGLSDVIGGAEF
DRMVLRDVVPGLDVLPNGMSPPNPSELLMSEQFRALLDYGSRHYDIVIVDTPPVLAVTDC
VLIGKHAATTLLVVRHGFHPLSEIRESVKRLRNGGVIVKGALFTDVPQRRVGYGTYYAGY
YGYESNAG
SITEWalker A557/559GKT
SITEWalker A'577/584LLIDADMR
SITEWalker B656/662VIVDTPP
SITE-648/-653YGSRHY
SITEY Cluster722/732YGTYYAGYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASIQENPINDPAAGDAVRLADYLVVLTESWRLIAVITAIGVFVGVLYAFLSHPVYRADAMIQVEDNSGSAKDALGELAS
               DAVRLADYLVVLTESWRLIAVITAIGVFVGVLYAFLSHPVYRADAMIQVEDNSGSAKDALGELAS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IFDTKATAAAEIELIRSRMVVGEAVSQLHLDIVVQPRYFPIVGAWFARRAGNDGVAAPMFGLKRFAWGGERIVVSKFDVP
IFDTKATAAAEIELIRSRMVVGEAVSQLHLDIVVQPRYFPIVGAWFARRAGNDGVAAPMFGLKRFAWGGERIVVSKFDVP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAWNRKTFVLKATADQSYELYDPDGNFVLRGKAGVEAGGALKDKGVAHLVVERLVARPETEFQLVRNSTLATIDAIQKSL
DAWNRKTFVLKATADQSYELYDPDGNFVLRGKAGVEAGGALKDKGVAHLVVERLVARPETEFQLVRNSTLATIDAIQKSL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TIDEKTKDSGIIGLKLDGADNARTTETVNAIARNYVKQNIDRKSAEAEHTLTFLDQQLPQLRKELDRAEDRYNAFRNKNG
TIDEKTKDSGIIGLKLDGADNARTTETVNAIARN                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVDLSEESRLLLQQIVDNKTKLLDLQQQRLGLAERFAPTHPSIAGLDAQIKAMQSTQDALTRRISMLPDTEQTALRLLRD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRVNTELYTNLLNSAQQLKIMKAGQVGNVRVVDYAELAERPFRPNRPVVVALAAVLGLLAGVIAAFVRKALYGGVEHSEE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IESIGLPVYGVVPHSEKQKQIHRGSQAGSANARVLAVEAPTDVAIEGVRSLRTALQFALLNAENNIVMVTGSRPEVGKTF
                                                                     TGSRPEVGKTF
                                                                            GKT 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISSNLSAVLAATGKRVLLIDADMRRGDVHTYFGLKRRAGLSDVIGGAEFDRMVLRDVVPGLDVLPNGMSPPNPSELLMSE
ISSNLSAVLAATGKRVLLIDADMRRGDVHTYFGLKRRAGLSDVIGGAEFDRMVLRDVVPGLDVLPNGMSPPNPSELLMSE
                LLIDADMR                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFRALLDYGSRHYDIVIVDTPPVLAVTDCVLIGKHAATTLLVVRHGFHPLSEIRESVKRLRNGGVIVKGALFTDVPQRRV
QFRALLDYGSRHYDIVIVDTPPVLAVTDCVLIGKHAATTLLVVRHGFHPLSEIRESVKRLRNGGVIVKGALFTDVPQRRV
               VIVDTPP                                                          
       730       
....:....|....:..
GYGTYYAGYYGYESNAG
GYGTYYAGYYGYESNAG
 YGTYYAGYYGY     

© 1998-2019