BYKdb

Annotate results for A0A132I1I7

A0A132I1I7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A132I1I7
DOMAINtad1/128MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPQIYASESQGFLAARAADQSLITSN
LPAESRAQAYVALINSEAVRERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQ
LANSALQA
DOMAINcd254/444TSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQ
PDDALAATGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDG
SLLATAVDGTVLVVRQGRTRKDHLEAAVENLAAVDAHLLGVVMNGVARSQRGGGYSYGYG
YESTYHKSYEK
SITEWalker A261/263GKS
SITEWalker A'281/288LVVDADLR
SITEWalker B360/366VIVDSPP
SITEY Cluster428/445YSYGYGYESTYHKSYEKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPQIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPQIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQA                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRRNVLVGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENESLTRTGEEAVDLDPRAGEAIRALRTNLK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
             TSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
                    GKS                 LVVDADLR                                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
                                       VIVDSPP                                  
       410       420       430       440       450       460       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSYEKYLSSVGSSARKERRSRHKARTRS
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSYEK                       
                           YSYGYGYESTYHKSYEKY                      
© 1998-2019