BYKdb

Annotate results for A0A133KEQ7

A0A133KEQ7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A133KEQ7
DOMAINcd39/217TSTKPSEGKSTVIYKLAKSFADNGERVILIDCDLRSPSLYEIAGINDNVGVTNYLTGKVS
IQRAINKDRDQANLDLIFTGPVPPNPAEILASQVFKKFIEDLSEVYDYVFIDTPPVGLFT
DASIVSTLCDGVIFVIKSSDTKKEDITLALDNLKKVDAHILGAVLTYVPMKDKRYGNYY
SITEWalker A46/48GKS
SITEWalker A'66/73ILIDCDLR
SITEWalker B147/153VFIDTPP
SITE-144/-146YDY
SITEY Cluster213/217YGNYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKKNTYYSASMYDEAIRSIRTNIQFSSLDKKNNIIAVTSTKPSEGKSTVIYKLAKSFADNGERVILIDCDLRSPSLYEI
                                      TSTKPSEGKSTVIYKLAKSFADNGERVILIDCDLRSPSLYEI
                                             GKS                 ILIDCDLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGINDNVGVTNYLTGKVSIQRAINKDRDQANLDLIFTGPVPPNPAEILASQVFKKFIEDLSEVYDYVFIDTPPVGLFTDA
AGINDNVGVTNYLTGKVSIQRAINKDRDQANLDLIFTGPVPPNPAEILASQVFKKFIEDLSEVYDYVFIDTPPVGLFTDA
                                                                  VFIDTPP       
       170       180       190       200       210       
....:....|....:....|....:....|....:....|....:....|....:..
SIVSTLCDGVIFVIKSSDTKKEDITLALDNLKKVDAHILGAVLTYVPMKDKRYGNYY
SIVSTLCDGVIFVIKSSDTKKEDITLALDNLKKVDAHILGAVLTYVPMKDKRYGNYY
                                                    YGNYY
© 1998-2019