BYKdb

Annotate results for A0A133LDL3

A0A133LDL3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A133LDL3
DOMAINcd45/223TSSKPSEGKTTVLYSIAKSFAENGNSVVLLDFDLRIPKVGKVAGIETNMGLTNVITGKVE
LNRALIKDQNEDNLFVMLSGPVPPNPAEILASNHVKELIKELSQRFDYVFLDTPPVGLFT
DASIVSTYCDGVIFAIKSNDTKKEEVSHALENLKKVNGKVLGAILTFADLKESTYKGYY
SITEWalker A52/54GKT
SITEWalker A'72/79VLLDFDLR
SITEWalker B153/159VFLDTPP
SITEY Cluster219/223YKGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKENKMAKKRGYYNTKSIFDEAIRSVRTNIQFSDIDDKKRVIAMTSSKPSEGKTTVLYSIAKSFAENGNSVVLLDFDLRI
                                            TSSKPSEGKTTVLYSIAKSFAENGNSVVLLDFDLRI
                                                   GKT                 VLLDFDLR 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PKVGKVAGIETNMGLTNVITGKVELNRALIKDQNEDNLFVMLSGPVPPNPAEILASNHVKELIKELSQRFDYVFLDTPPV
PKVGKVAGIETNMGLTNVITGKVELNRALIKDQNEDNLFVMLSGPVPPNPAEILASNHVKELIKELSQRFDYVFLDTPPV
                                                                        VFLDTPP 
       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
GLFTDASIVSTYCDGVIFAIKSNDTKKEEVSHALENLKKVNGKVLGAILTFADLKESTYKGYY
GLFTDASIVSTYCDGVIFAIKSNDTKKEEVSHALENLKKVNGKVLGAILTFADLKESTYKGYY
                                                          YKGYY
© 1998-2019