BYKdb

Annotate results for A0A133MSB7

A0A133MSB7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A133MSB7
DOMAINcd38/217TSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNFGISNSIGLSEFLIGKAE
FSKVVYKHESGLHVLPSGTIPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDS
KILSTKVDGTILVVKYGYTKKDAVMEAVKGLRAVKANIIGTVFNGEESQRGKYYHYYKKD
SITEWalker A45/47GKS
SITEWalker A'65/72IIIDCDLR
SITEWalker B144/150IILDTPP
SITE-141/-175YDYIILDTPPVNAVTDSKILSTKVDGTILVVKYGY
SITEY Cluster210/214YYHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLILESNSQSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNF
                                     TSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNF
                                            GKS                 IIIDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GISNSIGLSEFLIGKAEFSKVVYKHESGLHVLPSGTIPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
GISNSIGLSEFLIGKAEFSKVVYKHESGLHVLPSGTIPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
                                                               IILDTPP          
       170       180       190       200       210       
....:....|....:....|....:....|....:....|....:....|....:..
STKVDGTILVVKYGYTKKDAVMEAVKGLRAVKANIIGTVFNGEESQRGKYYHYYKKD
STKVDGTILVVKYGYTKKDAVMEAVKGLRAVKANIIGTVFNGEESQRGKYYHYYKKD
                                                 YYHYY   
© 1998-2019