BYKdb

Annotate results for A0A133MZD0

A0A133MZD0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A133MZD0
DOMAINcd56/237TSSGPDEGKSITAANLAVVFANSGKQVLLVDADLRKPTVALSFQLPHNEGLSNLLSERER
IADDYITETHIENLWILPSGPKPPNPSEVLGTKRMEEIIEELILDFDLVIFDMPPVATVT
DAQILAAKTDGTLLVVRERKTKKQELLKAKELLQIAKANILGVVYNGTKKESDLTYYYQS
FE
SITEWalker A63/65GKS
SITEWalker A'83/90LLVDADLR
SITEWalker B164/170VIFDMPP
SITEY Cluster231/233YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKESRENMKKKKIAASPVPLVALADQSITAEKYRTIRSNIQFAAIDRELNTLVITSSGPDEGKSITAANLAVVFANSGK
                                                       TSSGPDEGKSITAANLAVVFANSGK
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVLLVDADLRKPTVALSFQLPHNEGLSNLLSERERIADDYITETHIENLWILPSGPKPPNPSEVLGTKRMEEIIEELILD
QVLLVDADLRKPTVALSFQLPHNEGLSNLLSERERIADDYITETHIENLWILPSGPKPPNPSEVLGTKRMEEIIEELILD
  LLVDADLR                                                                      
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
FDLVIFDMPPVATVTDAQILAAKTDGTLLVVRERKTKKQELLKAKELLQIAKANILGVVYNGTKKESDLTYYYQSFE
FDLVIFDMPPVATVTDAQILAAKTDGTLLVVRERKTKKQELLKAKELLQIAKANILGVVYNGTKKESDLTYYYQSFE
   VIFDMPP                                                            YYY    
© 1998-2019