BYKdb

Annotate results for A0A133Q0D7

A0A133Q0D7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A133Q0D7
DOMAINcd50/231TSEKPAAGKSIISANIAITYAQAGYKTLIIDGDMRKPTQHYHFETTNYDGLSNLIIGKSN
FDKSIIKTRVKNLDLMTAGPTPPNPSELIGSAAFENILRDLNEIYDFILIDTPPVISVTD
AQVYLRYVPECVMIIDVQNNNKNEVKKAKELIEKVGGRVIGAVLNKTPKEKSSSYYYYGD
DE
SITE-106/-108GKS
SITEWalker A'77/84LIIDGDMR
SITEWalker B157/163ILIDTPP
SITE-69/-74YAQAGY
SITE-173/-227YLRYVPECVMIIDVQNNNKNEVKKAKELIEKVGGRVIGAVLNKTPKEKSSSYYYY
SITEWalker A57/59GKS
SITE-173/-176YLRY
SITEY Cluster224/227YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTKKNEKRKNLNTPLFTEDNSKSIVSEKVRGIRSNIMFSGVEEVKSIIVTSEKPAAGKSIISANIAITYAQAGYKTLIID
                                                 TSEKPAAGKSIISANIAITYAQAGYKTLIID
                                                        GKS                 LIID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDMRKPTQHYHFETTNYDGLSNLIIGKSNFDKSIIKTRVKNLDLMTAGPTPPNPSELIGSAAFENILRDLNEIYDFILID
GDMRKPTQHYHFETTNYDGLSNLIIGKSNFDKSIIKTRVKNLDLMTAGPTPPNPSELIGSAAFENILRDLNEIYDFILID
GDMR                                                                        ILID
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
TPPVISVTDAQVYLRYVPECVMIIDVQNNNKNEVKKAKELIEKVGGRVIGAVLNKTPKEKSSSYYYYGDDE
TPPVISVTDAQVYLRYVPECVMIIDVQNNNKNEVKKAKELIEKVGGRVIGAVLNKTPKEKSSSYYYYGDDE
TPP                                                            YYYY    
© 1998-2019