BYKdb

Annotate results for A0A133QRZ3

A0A133QRZ3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A133QRZ3
DOMAINcd55/237TSEKPGVGKSLVSANIAVTYAQAGYKTLLIDGDMRKPTQHYMFNTSNIDGLSNLIISKSY
FEKAITKTEIDNLDLLTSGPIPPNPSELIGSIQFQNHLEELKEIYDFIIIDTPPVNTVTD
AQLFSEISGYAALVINVKNNDRKSILKSKELIENTGAKVLGVVLNKTEHEKNSSYYAYYG
EES
SITEWalker A62/64GKS
SITEWalker A'82/89LLIDGDMR
SITEWalker B162/168IIIDTPP
SITE-74/-79YAQAGY
SITEY Cluster229/233YYAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIKENSQMKKKSKAINNPLMTHYDPKSVISEKFRGIRTNIMFSTANDDVKTLVITSEKPGVGKSLVSANIAVTYAQAGYK
                                                      TSEKPGVGKSLVSANIAVTYAQAGYK
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLLIDGDMRKPTQHYMFNTSNIDGLSNLIISKSYFEKAITKTEIDNLDLLTSGPIPPNPSELIGSIQFQNHLEELKEIYD
TLLIDGDMRKPTQHYMFNTSNIDGLSNLIISKSYFEKAITKTEIDNLDLLTSGPIPPNPSELIGSIQFQNHLEELKEIYD
 LLIDGDMR                                                                       
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
FIIIDTPPVNTVTDAQLFSEISGYAALVINVKNNDRKSILKSKELIENTGAKVLGVVLNKTEHEKNSSYYAYYGEES
FIIIDTPPVNTVTDAQLFSEISGYAALVINVKNNDRKSILKSKELIENTGAKVLGVVLNKTEHEKNSSYYAYYGEES
 IIIDTPP                                                            YYAYY    
© 1998-2019