BYKdb

Annotate results for A0A133ZSJ0

A0A133ZSJ0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A133ZSJ0
DOMAINcd41/234TSTSENEGKSTVSINLAISLAKLGLKTILVDADTRKSVMAGRFKFKNKISGLTNYLSGVS
PIEDVIYETDIQHLNVIPAGQVPPNPTGLLQNKNFNIMVEVFREYYDYVIIDTPPVGQVI
DAAIVAPKADGVVMVVEANRVKKKVVEKAKEQLEKGGAEFLGVILNKVNSNELGYGGYYG
HYGGYGNYGANKKT
SITEWalker A48/50GKS
SITEWalker A'68/75ILVDADTR
SITEWalker B149/155VIIDTPP
SITE-145/-148YYDY
SITEY Cluster215/228YGGYYGHYGGYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAQINLLTNKNIVDPKNEEYYNALRTNIQFLGKDKKVIVITSTSENEGKSTVSINLAISLAKLGLKTILVDADTRKSVMA
                                        TSTSENEGKSTVSINLAISLAKLGLKTILVDADTRKSVMA
                                               GKS                 ILVDADTR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRFKFKNKISGLTNYLSGVSPIEDVIYETDIQHLNVIPAGQVPPNPTGLLQNKNFNIMVEVFREYYDYVIIDTPPVGQVI
GRFKFKNKISGLTNYLSGVSPIEDVIYETDIQHLNVIPAGQVPPNPTGLLQNKNFNIMVEVFREYYDYVIIDTPPVGQVI
                                                                    VIIDTPP     
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
DAAIVAPKADGVVMVVEANRVKKKVVEKAKEQLEKGGAEFLGVILNKVNSNELGYGGYYGHYGGYGNYGANKKTDKK
DAAIVAPKADGVVMVVEANRVKKKVVEKAKEQLEKGGAEFLGVILNKVNSNELGYGGYYGHYGGYGNYGANKKT   
                                                      YGGYYGHYGGYGNY         
© 1998-2019