BYKdb

Annotate results for A0A135HTW1

A0A135HTW1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A135HTW1
DOMAINtad24/207NFIDIEQLLAMARRQAKTVAIVAAIGLMLGIVSLIFSTSYYTAGTSILLDDNLGKLADEP
SPMPANAQTDATILSQIAILKSTELAAKVVDREKLTENATFMNPPRSLLSRIKGVAQGVM
GVFRGGGKEADDTSSSAGPRMYAASILQSNLNVERQGRSFVIDLNYTSNDPVLAGRIARA
YADV
DOMAINcd570/761ISALPNEGKSTVAANFAGLLAANGAKTLLVDGDLRNPGLTRALSLAPQKGLVEVVVGEVP
WQSAVKIDSKTKLAILPAVVPRHLSHTSELISCAGMKNFLDEARGVFEYIIVDLPPLGPV
VDSKAFAPLADGFVMVTEWGVTPRPLVKSMLQAENLIAPKILGLVLNKADMKRLSQYSAY
GSSEHFMDRYSS
SITEWalker A577/579GKS
SITEWalker A'597/604LLVDGDLR
SITEWalker B679/685IIVDLPP
SITEY Cluster746/763YSAYGSSEHFMDRYSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHQGNLPFNGRLAVNAKGQADADNFIDIEQLLAMARRQAKTVAIVAAIGLMLGIVSLIFSTSYYTAGTSILLDDNLGKLA
                       NFIDIEQLLAMARRQAKTVAIVAAIGLMLGIVSLIFSTSYYTAGTSILLDDNLGKLA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEPSPMPANAQTDATILSQIAILKSTELAAKVVDREKLTENATFMNPPRSLLSRIKGVAQGVMGVFRGGGKEADDTSSSA
DEPSPMPANAQTDATILSQIAILKSTELAAKVVDREKLTENATFMNPPRSLLSRIKGVAQGVMGVFRGGGKEADDTSSSA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPRMYAASILQSNLNVERQGRSFVIDLNYTSNDPVLAGRIARAYADVYLADQLDANFDATQRATVWLQGRLVDLKESSQK
GPRMYAASILQSNLNVERQGRSFVIDLNYTSNDPVLAGRIARAYADV                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AALEVERYRAENGLTAAKGALVSEQQLSDLNSQFILAQAETARALAQYNQYKSILNGGPEAAVNNAAVLSDQLNASVIAP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRTRYLTISKRIQEITSRYGKDHPQAVSLRTEQQEVGRQIFQELQQATASLRNQYEVAKSRETSLRESLQKVTGETSTAN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSLVHLRELEQRSQALGDLYQTYLKRYQEASQQQSFPIAKARIISVASKPTDASSPKKKMVLAASLLLGLFAGAGIGAWR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFRERFFRVGEEVRAILGVKFLGYLPAVIGSSDAGTRGSSDDQGPAPRVTNMMRVAIDSPASAFAETLRNAKVAADVVLQ


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRESKVIGIISALPNEGKSTVAANFAGLLAANGAKTLLVDGDLRNPGLTRALSLAPQKGLVEVVVGEVPWQSAVKIDSKT
         ISALPNEGKSTVAANFAGLLAANGAKTLLVDGDLRNPGLTRALSLAPQKGLVEVVVGEVPWQSAVKIDSKT
                GKS                 LLVDGDLR                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLAILPAVVPRHLSHTSELISCAGMKNFLDEARGVFEYIIVDLPPLGPVVDSKAFAPLADGFVMVTEWGVTPRPLVKSML
KLAILPAVVPRHLSHTSELISCAGMKNFLDEARGVFEYIIVDLPPLGPVVDSKAFAPLADGFVMVTEWGVTPRPLVKSML
                                      IIVDLPP                                   
       730       740       750       760       770   
....:....|....:....|....:....|....:....|....:....|...
QAENLIAPKILGLVLNKADMKRLSQYSAYGSSEHFMDRYSSYYLDDASASGKS
QAENLIAPKILGLVLNKADMKRLSQYSAYGSSEHFMDRYSS            
                         YSAYGSSEHFMDRYSSYY          

© 1998-2019