BYKdb

Annotate results for A0A135IQD2

A0A135IQD2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A135IQD2
DOMAINtad26/211EVLDLGALFAIIWRGRWVIAACVLIGLIVGIWRAYIVATPLYGAEVQLVLDPRDEKVVDI
ESVVSSLSATDEVIRTEVHILGGRELAGQVVDRLNLISDPEFNMMLRDPGFNPVQVLKDM
IKGILGMQVYDTSLTPDPAFVREKVIQTLLTNTRVVNIPDTYIFSIWVLSENPFKAADIA
NAFADT
DOMAINcd515/703TSAESGDGKSTLSAAMAHNMAQIGKSVLLVDGDLRRHYLSDPLADGNSKPGLFDVLSGRC
DLAEAVLPGVLGQADILPAGSVSGSAADLLSQGGLTELLSVARSHWDIIIFDTPPISVVP
DARIIGQHADLLILLAQWNTTRQAVFIDALRALEQGGRSPDGIVLTKVKAAAKPLYGATK
RSRDRYYHG
SITE-538/-540GKS
SITEWalker A'542/549LLVDGDLR
SITEWalker B623/629IIFDTPP
SITEY Cluster700/701YY
SITEWalker A522/524GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGKPTTMGSTNVSTPKTSFAAADGQEVLDLGALFAIIWRGRWVIAACVLIGLIVGIWRAYIVATPLYGAEVQLVLDPRDE
                         EVLDLGALFAIIWRGRWVIAACVLIGLIVGIWRAYIVATPLYGAEVQLVLDPRDE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVVDIESVVSSLSATDEVIRTEVHILGGRELAGQVVDRLNLISDPEFNMMLRDPGFNPVQVLKDMIKGILGMQVYDTSLT
KVVDIESVVSSLSATDEVIRTEVHILGGRELAGQVVDRLNLISDPEFNMMLRDPGFNPVQVLKDMIKGILGMQVYDTSLT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDPAFVREKVIQTLLTNTRVVNIPDTYIFSIWVLSENPFKAADIANAFADTYVENQVAVKLNVTEQATGWLAERVTELRS
PDPAFVREKVIQTLLTNTRVVNIPDTYIFSIWVLSENPFKAADIANAFADT                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLEANERRVADIRAQADVTSPAQLIGLENRLISLRSALVERAAEVAEQQARQAEFTTLQTVEDQRLAARRNGYGAILARA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNPQDGWRSVLAQLTRDLREAEAKEQAIRRSMADLEITIATQSDALTEVVQAERDAEASRLLFENFQNRLRETSMQIGLQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RADSRVISRAFPPDRPALPNKGQILILSVFLSGFLGTVLVVVLQLSRARLHSAAQIAGLTSVPVIAVLDQFSQKIRPEQA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SALGPQTRDGEAIRNLRTTLLMARGDVPPQVVVFTSAESGDGKSTLSAAMAHNMAQIGKSVLLVDGDLRRHYLSDPLADG
                                  TSAESGDGKSTLSAAMAHNMAQIGKSVLLVDGDLRRHYLSDPLADG
                                         GKS                 LLVDGDLR           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSKPGLFDVLSGRCDLAEAVLPGVLGQADILPAGSVSGSAADLLSQGGLTELLSVARSHWDIIIFDTPPISVVPDARIIG
NSKPGLFDVLSGRCDLAEAVLPGVLGQADILPAGSVSGSAADLLSQGGLTELLSVARSHWDIIIFDTPPISVVPDARIIG
                                                              IIFDTPP           
       650       660       670       680       690       700   
....:....|....:....|....:....|....:....|....:....|....:....|...
QHADLLILLAQWNTTRQAVFIDALRALEQGGRSPDGIVLTKVKAAAKPLYGATKRSRDRYYHG
QHADLLILLAQWNTTRQAVFIDALRALEQGGRSPDGIVLTKVKAAAKPLYGATKRSRDRYYHG
                                                           YY  

© 1998-2019