BYKdb

Annotate results for A0A135WPN8

A0A135WPN8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A135WPN8
DOMAINcd54/236TSASPNEGKSTVASNVAIVFAQEGKKVLLVDADMRKPTTHYTFKTANAHGLTNVLTNQST
WQEVITETPISGLDILPCGPIPPNPAELIGSQKMVLLIEQLKQAYDLIIFDTPPILSVTD
AQILSNKCDGAILVINSGTSEKESVQKAAEALQNSKANVIGTVLNNYKLAKDHYYYQYYG
NAE
SITEWalker A61/63GKS
SITEWalker A'81/88LLVDADMR
SITEWalker B161/167IIFDTPP
SITEY Cluster227/232YYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFVFKKKPKIIQAAARKIVTFTNPRSVVSEQFKTIRTNINFSMPDQKLEALMFTSASPNEGKSTVASNVAIVFAQEGKKV
                                                     TSASPNEGKSTVASNVAIVFAQEGKKV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVDADMRKPTTHYTFKTANAHGLTNVLTNQSTWQEVITETPISGLDILPCGPIPPNPAELIGSQKMVLLIEQLKQAYDL
LLVDADMRKPTTHYTFKTANAHGLTNVLTNQSTWQEVITETPISGLDILPCGPIPPNPAELIGSQKMVLLIEQLKQAYDL
LLVDADMR                                                                        
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
IIFDTPPILSVTDAQILSNKCDGAILVINSGTSEKESVQKAAEALQNSKANVIGTVLNNYKLAKDHYYYQYYGNAE
IIFDTPPILSVTDAQILSNKCDGAILVINSGTSEKESVQKAAEALQNSKANVIGTVLNNYKLAKDHYYYQYYGNAE
IIFDTPP                                                           YYYQYY    
© 1998-2019