BYKdb

Annotate results for A0A135YX31

A0A135YX31 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A135YX31
DOMAINcd41/230TSAQAGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMSGTFKSNERYQGLTSFLSGNA
ELSDVICDTTIDNLMIIPAGQVPPNPTSLIQNDNFKTMIETVRGLYDYVIIDTPPLGLVI
DAAILAHYSDASLVVAKAGVDKRRTITKLKEQLEQSGSIFLGVILNKYDIHLDNYGAYGS
YDGYGTYGAK
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADTR
SITEWalker B149/155VIIDTPP
SITE-146/-148YDY
SITEY Cluster215/227YGAYGSYDGYGTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPQLELVRAKAQMVKSMEEYYNSIRTNVQFSGRDLKVITLTSAQAGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
                                        TSAQAGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
                                               GKS                 LLIDADTR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTFKSNERYQGLTSFLSGNAELSDVICDTTIDNLMIIPAGQVPPNPTSLIQNDNFKTMIETVRGLYDYVIIDTPPLGLVI
GTFKSNERYQGLTSFLSGNAELSDVICDTTIDNLMIIPAGQVPPNPTSLIQNDNFKTMIETVRGLYDYVIIDTPPLGLVI
                                                                    VIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAAILAHYSDASLVVAKAGVDKRRTITKLKEQLEQSGSIFLGVILNKYDIHLDNYGAYGSYDGYGTYGAKEERSKKGKGR
DAAILAHYSDASLVVAKAGVDKRRTITKLKEQLEQSGSIFLGVILNKYDIHLDNYGAYGSYDGYGTYGAK          
                                                      YGAYGSYDGYGTY             
   
...
RRK


© 1998-2019