BYKdb

Annotate results for A0A136HS33

A0A136HS33 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A136HS33
DOMAINtad18/206DIIDLTHYFRVINQSKWRIFSLSIVITFLVALIVLSMTPIFKATSSLLIESEETNIVSIE
QVYGLDSSKKEYFETQYEILKSRHIAEKVVDKLDLGNNPIFVEMLNEGEASLINDIKASI
KGVLTFLPQKDAEPLTEEEKAELRKEKLISLFSEELSITPVANTQVVKISYMSESPKLAA
LIANTVAEV
DOMAINcd550/740TSSVPKEGKTTVSINLGFAMGQLGKTLLIDADLRKPSVAKRFGLPGFQPGLSNLIAGTHT
LDECLCNDVASGIDVITAGSSSPNAQELLMSNNFKEVIDALRNDYEHIIIDTAPTQAVSD
AIIVSEKADTLLYVVKADATNEKLVSSGLERFMRVGKRIDGVILNQVDIKKASSNYAYTG
YYDQYGYGADT
SITE-573/-575GKT
SITEWalker A'576/583LLIDADLR
SITEWalker B657/663IIIDTAP
SITEY Cluster725/736YAYTGYYDQYGY
SITEWalker A557/559GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLSEGNDIRTAQQDADEDIIDLTHYFRVINQSKWRIFSLSIVITFLVALIVLSMTPIFKATSSLLIESEETNIVSIEQVY
                 DIIDLTHYFRVINQSKWRIFSLSIVITFLVALIVLSMTPIFKATSSLLIESEETNIVSIEQVY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLDSSKKEYFETQYEILKSRHIAEKVVDKLDLGNNPIFVEMLNEGEASLINDIKASIKGVLTFLPQKDAEPLTEEEKAEL
GLDSSKKEYFETQYEILKSRHIAEKVVDKLDLGNNPIFVEMLNEGEASLINDIKASIKGVLTFLPQKDAEPLTEEEKAEL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKEKLISLFSEELSITPVANTQVVKISYMSESPKLAALIANTVAEVYIDNYLEAKFDMTSKATTWLNDSLEGLRTKLEAS
RKEKLISLFSEELSITPVANTQVVKISYMSESPKLAALIANTVAEV                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERKLAEFYEREQLVDLDGVVGLASEELSGLSEQLLQAENRLKQSEIIYEQVQNFNGDPTELAAMPAVQNHPSIQNVKEAE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKAESNVSELSKVYGPKHQKMISAQAELASVKQTLQNQVAALISGITSEYRQAQSQVNRLRLAVSSAKEEFRKLTTLESK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKVLQREVDTNQQLYDSFFTRLQETSEVEGFETANARVLDKATMPTEPAKPKKSIILVATLILTLGFGVFIALVQDFLNS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVRSVDDVERKLGQRMMGLIPWQPHKKKEDLPLREFFDKSNHTFSEAIRTLRTSIQLLDLSGDKKVVMVTSSVPKEGKTT
                                                                     TSSVPKEGKTT
                                                                            GKT 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSINLGFAMGQLGKTLLIDADLRKPSVAKRFGLPGFQPGLSNLIAGTHTLDECLCNDVASGIDVITAGSSSPNAQELLMS
VSINLGFAMGQLGKTLLIDADLRKPSVAKRFGLPGFQPGLSNLIAGTHTLDECLCNDVASGIDVITAGSSSPNAQELLMS
               LLIDADLR                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNFKEVIDALRNDYEHIIIDTAPTQAVSDAIIVSEKADTLLYVVKADATNEKLVSSGLERFMRVGKRIDGVILNQVDIKK
NNFKEVIDALRNDYEHIIIDTAPTQAVSDAIIVSEKADTLLYVVKADATNEKLVSSGLERFMRVGKRIDGVILNQVDIKK
                IIIDTAP                                                         
       730       740       750   
....:....|....:....|....:....|...
ASSNYAYTGYYDQYGYGADTDTSTASGAKSNQA
ASSNYAYTGYYDQYGYGADT             
    YAYTGYYDQYGY                 

© 1998-2019