BYKdb

Annotate results for A0A136JPP4

A0A136JPP4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A136JPP4
DOMAINtad38/236GKRTLRQYVRVVTKRLPMIGAIAVVVTAAAAFYSFRQPSIYSASTEMLIEPRKAAPTAKD
AININFGLDETTYYNTQLQLLQNPDLMKKAVVALGLQREPDLFGSSNRGFFASIKSLFVS
PKSPETPKGALPVLTGTENADPAAVQLSPEEAARAGQYAGILSGGLHVEQTERTSLFTLT
INSTNPQIAANVANKVGEV
DOMAINcd633/823TSSQPSEGKTMTAINTAITLAQADADVVLIDCDLRRPRMHSHFGLSNSQGLTNYLSGEKS
TENLIKAAPGLPHLKIITSGPIPPNPAELLSSNEMRNLLQFLRGRFKHIIIDSPPAISFT
DAAILSTQVDGVVLIAMAGKSSMHLMRQTRTRISALGARIYGVVLNGITSESVEYDYYGT
GYYTYYKNRPD
SITE-771/-773GKS
SITEWalker A'660/667VLIDCDLR
SITEWalker B741/747IIIDSPP
SITEY Cluster807/818YDYYGTGYYTYY
SITEWalker A640/642GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDQDQRLTPLPKGLELNQPAGDLTTSYAAYYDHESQSGKRTLRQYVRVVTKRLPMIGAIAVVVTAAAAFYSFRQPSIYSA
                                     GKRTLRQYVRVVTKRLPMIGAIAVVVTAAAAFYSFRQPSIYSA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STEMLIEPRKAAPTAKDAININFGLDETTYYNTQLQLLQNPDLMKKAVVALGLQREPDLFGSSNRGFFASIKSLFVSPKS
STEMLIEPRKAAPTAKDAININFGLDETTYYNTQLQLLQNPDLMKKAVVALGLQREPDLFGSSNRGFFASIKSLFVSPKS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PETPKGALPVLTGTENADPAAVQLSPEEAARAGQYAGILSGGLHVEQTERTSLFTLTINSTNPQIAANVANKVGEVFIEE
PETPKGALPVLTGTENADPAAVQLSPEEAARAGQYAGILSGGLHVEQTERTSLFTLTINSTNPQIAANVANKVGEV    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAKRELETTQSAYDELTKSIADLKVTIADQENKLTEYMRSSNLPLQEKGSDLAASRLQTLSEQWLSAADDRRKLEARYNG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVQASSRGEGRNIPDLYENKVYQDTVRLNTERKAKLQDQIREIEKQIKDAETEKAELLVKYTPEYVKVKQVEEKIASLKT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKQQTETEVSQIIDRDQKKIEKDAVSGALVSLRSQVDAARRREDQLLNAYEVEAERANVQGQAATTLTTLKRALETNRGL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDTYTQRQKEQELALASGKPNNIKISERAEAPTYPVGPNRARNIFIALLASLGAGIGLAFLLDYLDDSIRTSDDISRALG


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPTLAMIPHHGINEKKRRSRRGLGSETNAKAASNTALITLEERHSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEG
                                                                        TSSQPSEG
                                                                               G
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTMTAINTAITLAQADADVVLIDCDLRRPRMHSHFGLSNSQGLTNYLSGEKSTENLIKAAPGLPHLKIITSGPIPPNPAE
KTMTAINTAITLAQADADVVLIDCDLRRPRMHSHFGLSNSQGLTNYLSGEKSTENLIKAAPGLPHLKIITSGPIPPNPAE
KT                 VLIDCDLR                                                     
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLSSNEMRNLLQFLRGRFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSMHLMRQTRTRISALGARIYGVVLNGI
LLSSNEMRNLLQFLRGRFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSMHLMRQTRTRISALGARIYGVVLNGI
                    IIIDSPP                                                     
       810       820       830       840       
....:....|....:....|....:....|....:....|....:..
TSESVEYDYYGTGYYTYYKNRPDDTTPIMDDADVVGQYGNSADSFKP
TSESVEYDYYGTGYYTYYKNRPD                        
      YDYYGTGYYTYY                             

© 1998-2019