BYKdb

Annotate results for A0A136JVD6

A0A136JVD6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A136JVD6
DOMAINtad11/192AEQTLSEYATACWRHRWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVIDNPTPGGLDKD
KSFYPDNSPEYFQTHFELMKSHFVLQRTARLLDLAERDEYQPKPSVIRQFVKSLMPESVL
AFVRPPKKEEVDPADDAEEALIKQFAQDIEIMPIRGARLAHVTANAIEPELAAQIANTLV
SV
DOMAINcd544/731TSPGENEGKTTLAVNLAMAMAQLEDTQVVLIDVDFRNQQIHPLYEVGSPEQPPKGLGHLL
RGEASLADVVHQTFVSNLSVIPHGGRPANPTELLHSKSMAQLLNWGATNRYHIILDCPPV
LPIADAAVLASKVDGVLLVVSAGETTRDACHLAIQRIKQAGGRLLGVVMQKAPVADSPYY
YGAYQQQR
SITEWalker A551/553GKT
SITEWalker A'572/579VLIDVDFR
SITEWalker B656/662IILDCPP
SITEY Cluster722/727YYYGAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNAKPMVLDEAEQTLSEYATACWRHRWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVIDNPTPGGLDKDKSFYPDNSPE
          AEQTLSEYATACWRHRWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVIDNPTPGGLDKDKSFYPDNSPE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YFQTHFELMKSHFVLQRTARLLDLAERDEYQPKPSVIRQFVKSLMPESVLAFVRPPKKEEVDPADDAEEALIKQFAQDIE
YFQTHFELMKSHFVLQRTARLLDLAERDEYQPKPSVIRQFVKSLMPESVLAFVRPPKKEEVDPADDAEEALIKQFAQDIE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IMPIRGARLAHVTANAIEPELAAQIANTLVSVYIERNQELSANSKEQAAQWFTTHLEELRQKVQNSQQALYLFRAKHGLL
IMPIRGARLAHVTANAIEPELAAQIANTLVSV                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGEERKSVAAHTLAELNSQLVKTEMAKAEAHSRFLQIRSVLNPQGAGTAGLDWSKLDSQIQVLNSPLIQTLRAQEITVSA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVAELSEKYGPLHPKLAHMKAELQDLRQRTQQEVQKIYDSVKHQYDMALAQDKAVKEAITRYNTDKIRLEQNEIEHSMLE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDAETSQHLYDVFLKATKETDLSSGMRANNVYLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADVERYLPNVSLLGVVPRLSKAAAQKKALAPPNALTPVAESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLA
                                                               TSPGENEGKTTLAVNLA
                                                                      GKT       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAMAQLEDTQVVLIDVDFRNQQIHPLYEVGSPEQPPKGLGHLLRGEASLADVVHQTFVSNLSVIPHGGRPANPTELLHSK
MAMAQLEDTQVVLIDVDFRNQQIHPLYEVGSPEQPPKGLGHLLRGEASLADVVHQTFVSNLSVIPHGGRPANPTELLHSK
           VLIDVDFR                                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SMAQLLNWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETTRDACHLAIQRIKQAGGRLLGVVMQKAPVADS
SMAQLLNWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETTRDACHLAIQRIKQAGGRLLGVVMQKAPVADS
               IILDCPP                                                          
       730 
....:....|.
PYYYGAYQQQR
PYYYGAYQQQR
 YYYGAY    

© 1998-2019