BYKdb

Annotate results for A0A136K497

A0A136K497 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A136K497
DOMAINcd142/329ASVNPSEGKSVTAVNLAWMLAQTDGVCALIIDSDLRMPSLADYLGIETEKGLSDILTGDA
NFKDTIVKLEPSGLYLLAGGAARPDVAELISGPKFAEILAEAREMFDYVIIDAPPLAIFT
DATVLINKADGALLVVRANRTKYGALDRILEPLPKDRMLGVILNQSEEVLDESHYNYGYY
NYRRMAED
SITEWalker A149/151GKS
SITEWalker A'170/177LIIDSDLR
SITEWalker B250/256VIIDAPP
SITEY Cluster316/323YNYGYYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVLQALQRKNIENPTTSKPRVVAFDANGKRNAPPDILGTELTIGSPRSAFDGQPNSSLGTALPDVETGLTAGAKPNADT


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTRSARRPLPDCVSWTVDAERVEPRLVAITSPNSSYCEEYRSLRTHVLHKSQRQHLKSIVVASVNPSEGKSVTAVNLAWM
                                                             ASVNPSEGKSVTAVNLAWM
                                                                    GKS         
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAQTDGVCALIIDSDLRMPSLADYLGIETEKGLSDILTGDANFKDTIVKLEPSGLYLLAGGAARPDVAELISGPKFAEIL
LAQTDGVCALIIDSDLRMPSLADYLGIETEKGLSDILTGDANFKDTIVKLEPSGLYLLAGGAARPDVAELISGPKFAEIL
         LIIDSDLR                                                               
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAREMFDYVIIDAPPLAIFTDATVLINKADGALLVVRANRTKYGALDRILEPLPKDRMLGVILNQSEEVLDESHYNYGY
AEAREMFDYVIIDAPPLAIFTDATVLINKADGALLVVRANRTKYGALDRILEPLPKDRMLGVILNQSEEVLDESHYNYGY
         VIIDAPP                                                           YNYGY
       330  
....:....|..
YNYRRMAEDAAS
YNYRRMAED   
YNY         
© 1998-2019