BYKdb

Annotate results for A0A136KC10

A0A136KC10 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A136KC10
DOMAINtad27/233EGFQLIDYWRAIRKRLWLVAGIAVVMTTLATIYIARKPNVYRAKAVVQVDNEQVNPDLVT
NDRARPISNADPSYFNTQLQLLWSESLLRRVVKEHNLDANPEFQALARTDSTSTFGRILR
SVGLASGETQKSEQLAAIDPNSTLASADEIAEAVRLTPFVEVIRRSLSVDPVRESRATVK
DTRLIEISFNSTDPALAAFVANAIAET
DOMAINcd615/807TSSLPSEGKTTTATNTAISLAQTGAQVLIIDADMRRPRLHSVFGIGNADGLSTILANELS
EAEILNLITQDPSSKLHLLPSGPIPPNPAELIGSEQMAKLLKTLEGHFTHVVVDSPPIAS
FTDGVLIASMVDGVILVVHSGKSSRQVVRRSRQLLNDIGAKILGVVLNNVNLRAQDNYYY
YQSYYTRDNYRSG
SITE-755/-757GKS
SITEWalker A'642/649LIIDADMR
SITEWalker B725/731VVVDSPP
SITEY Cluster792/804YYYYQSYYTRDNY
SITEWalker A622/624GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEMERPADPTIAATGRYPGYPQTGQAEGFQLIDYWRAIRKRLWLVAGIAVVMTTLATIYIARKPNVYRAKAVVQVDNEQV
                          EGFQLIDYWRAIRKRLWLVAGIAVVMTTLATIYIARKPNVYRAKAVVQVDNEQV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPDLVTNDRARPISNADPSYFNTQLQLLWSESLLRRVVKEHNLDANPEFQALARTDSTSTFGRILRSVGLASGETQKSEQ
NPDLVTNDRARPISNADPSYFNTQLQLLWSESLLRRVVKEHNLDANPEFQALARTDSTSTFGRILRSVGLASGETQKSEQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAAIDPNSTLASADEIAEAVRLTPFVEVIRRSLSVDPVRESRATVKDTRLIEISFNSTDPALAAFVANAIAETFVNQNQE
LAAIDPNSTLASADEIAEAVRLTPFVEVIRRSLSVDPVRESRATVKDTRLIEISFNSTDPALAAFVANAIAET       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRTGTSRKTNDFLQERIASLQSDIRRDEEKLVEMTQNAGILKTSDDSTIVMDRLSGLNKSMLEAENARKNAEANYFEVAK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPERLAAMAEAEMARFITEQQNNIRAFQSDTLKKISDLRQARALKLQEYQEGAPEIKEIDAQITSYQNSIDNAVQKFQGD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEKYREATKKTLLYNLQTKYLQAKANEDKIRADFNKQFGEATGQNQSAVSLALLKQTIDTNKGFLENLQKQVSSNDVAAQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSDNNISVTEPAVPSNIPVSPRRLATVLGALFLSTLFGMGLALFLEYLDDTVHSTEEVESLLHLPALAAIPTIQSMPKRR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQLVGEGGETPEDRPGSELLIHADPRSSLAEAYRQLRTSILLSTAGHAPKSLLITSSLPSEGKTTTATNTAISLAQTGAQ
                                                      TSSLPSEGKTTTATNTAISLAQTGAQ
                                                             GKT                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIIDADMRRPRLHSVFGIGNADGLSTILANELSEAEILNLITQDPSSKLHLLPSGPIPPNPAELIGSEQMAKLLKTLEG
VLIIDADMRRPRLHSVFGIGNADGLSTILANELSEAEILNLITQDPSSKLHLLPSGPIPPNPAELIGSEQMAKLLKTLEG
 LIIDADMR                                                                       
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HFTHVVVDSPPIASFTDGVLIASMVDGVILVVHSGKSSRQVVRRSRQLLNDIGAKILGVVLNNVNLRAQDNYYYYQSYYT
HFTHVVVDSPPIASFTDGVLIASMVDGVILVVHSGKSSRQVVRRSRQLLNDIGAKILGVVLNNVNLRAQDNYYYYQSYYT
    VVVDSPP                                                            YYYYQSYYT
       810
....:....|
RDNYRSGDDA
RDNYRSG   
RDNY      

© 1998-2019