BYKdb

Annotate results for A0A136LSC7

A0A136LSC7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A136LSC7
DOMAINcd576/764TSTVSGEGKSFLAMNLGGVLALSRKRVILVDLDMRKPKSEKYPTGNDSSMGMSTILIKKN
NWQECVLKTSLENFDFIPSGPHPPNPSELLLNGEFSDFLEELRATYDYVVIDTPPVGLVT
DGVMAMKRSDLSIYVFRANYSHKDFLQNLARVVTLNKLTHVSSVLNAIPLSGNYYGYGYY
EDKTPRRKR
SITEWalker A583/585GKS
SITEWalker A'603/610ILVDLDMR
SITEWalker B684/690VVIDTPP
SITE-681/-715YDYVVIDTPPVGLVTDGVMAMKRSDLSIYVFRANY
SITEY Cluster749/755YYGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQPKEIGPQVQSIDTEKLSAVIRKNLVWIVLIFIAVNLAAYLTIRYTKDLFESESEMKLDIKRDATELGIKTYMEDQNV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQVSGEIEQIKSKIFFNQVLDSLDFEVSYYSLGKVLTDEMYKRSPFRIKASHINPKHYDQPIYFDFLDNNEVSLRLKGAV


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STRGSMGNPVEFDGTVLTITKTNYFTENDGNNYYFVLNSRKSLIEYLSKNIQVDPLNFNANTIRVSFRDHNAHKAYDVVN


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIDSLYIVYSNQQKNLANKQKIEWLNNELVQVEEKMEGYENYFESFTLQNKSSDLTLDLKKTIAAINVVDSQRYSLNKQL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELNTLIDQITASDFANAIRPANSFPESILQRIEELHKKTRERDKLALAYNENTFAFRQKEREVSLVKDELFNQLSTLKK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EWLADMAELGKRKEKLERAFAEMPDKNTQFSKNQRYYKLYEEFYLTMMQSKAEFEIAQAGSTPDFKILSPATLPIKPISP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKVMVLGIGFVAAIVLCLFFIGLVYLLNNKITSVKEVERGINLPMLGAIPASHHTVQSLFHVIDNPKSIVSEAIRTLRTN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEFFNTGEKCKVITITSTVSGEGKSFLAMNLGGVLALSRKRVILVDLDMRKPKSEKYPTGNDSSMGMSTILIKKNNWQEC
               TSTVSGEGKSFLAMNLGGVLALSRKRVILVDLDMRKPKSEKYPTGNDSSMGMSTILIKKNNWQEC
                      GKS                 ILVDLDMR                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLKTSLENFDFIPSGPHPPNPSELLLNGEFSDFLEELRATYDYVVIDTPPVGLVTDGVMAMKRSDLSIYVFRANYSHKDF
VLKTSLENFDFIPSGPHPPNPSELLLNGEFSDFLEELRATYDYVVIDTPPVGLVTDGVMAMKRSDLSIYVFRANYSHKDF
                                           VVIDTPP                              
       730       740       750       760       770  
....:....|....:....|....:....|....:....|....:....|..
LQNLARVVTLNKLTHVSSVLNAIPLSGNYYGYGYYEDKTPRRKRWIKIFGLK
LQNLARVVTLNKLTHVSSVLNAIPLSGNYYGYGYYEDKTPRRKR        
                            YYGYGYY                 

© 1998-2019