BYKdb

Annotate results for A0A136N8H5

A0A136N8H5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A136N8H5
DOMAINcd212/400TSSIPREGKTIISSNLAASFALSSRVLLLDCDFRKPRMHNIFNMKRYPGLCDYLFGTVPI
EDAVRETSFPNLHIMTCGTIPTNPAELIASKHMQTFLNMIKPKYDYILIDSPPLATVTDA
ELLSSYVDGTVVVCLASKTRLDLLVNTIDTLNKINDTFIGVILNNFDYQATYGSYYKYYY
YYYGSEKGK
SITEWalker A219/221GKT
SITEWalker A'238/245LLLDCDFR
SITEWalker B318/324ILIDSPP
SITE-258/-317YPGLCDYLFGTVPIEDAVRETSFPNLHIMTCGTIPTNPAELIASKHMQTFLNMIKPKYDY
SITEY Cluster379/394YQATYGSYYKYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKEGAQSNTPDEMRSLTYKYFETKIVNNQNKIKEGLLKNYMNKYQEKFNKLPAQSIEYANLERERLANEKVYLMLLEKYQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EALINEESQPNNVKIIDYGKVPKAPSKPNRFLIITIGLLIGLGLGYGFALLRNILDVSVKSPEDLENIGISLIGWVPTFM


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REPKAGRHTHTEQELVLAYNSDSVPAEAFRTLRTRLQFSKLEPEPIKTILITSSIPREGKTIISSNLAASFALSSRVLLL
                                                   TSSIPREGKTIISSNLAASFALSSRVLLL
                                                          GKT                LLL
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DCDFRKPRMHNIFNMKRYPGLCDYLFGTVPIEDAVRETSFPNLHIMTCGTIPTNPAELIASKHMQTFLNMIKPKYDYILI
DCDFRKPRMHNIFNMKRYPGLCDYLFGTVPIEDAVRETSFPNLHIMTCGTIPTNPAELIASKHMQTFLNMIKPKYDYILI
DCDFR                                                                        ILI
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSPPLATVTDAELLSSYVDGTVVVCLASKTRLDLLVNTIDTLNKINDTFIGVILNNFDYQATYGSYYKYYYYYYGSEKGK
DSPPLATVTDAELLSSYVDGTVVVCLASKTRLDLLVNTIDTLNKINDTFIGVILNNFDYQATYGSYYKYYYYYYGSEKGK
DSPP                                                      YQATYGSYYKYYYYYY      
       410       420        
....:....|....:....|....:...
EGASATNGKSSNGVNNNGNLKEKTIKPN


© 1998-2019