BYKdb

Annotate results for A0A136PFK4

A0A136PFK4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A136PFK4
DOMAINtad98/275NRLQWLDYVGLLWRGKWIILACLLVMGSLAAWYTYSLPFIYESSLQILVNEKDQSIDLLN
NRNYWSNTDRELKKELQILTSRPIYEKAAQRLLTLRYTDTIRRKTVLPMLVAVEAKLGTA
SHNQSSQDRHARLIDEVVESLHKMIEVKPSKDADIIQVITRAGDPLEAALVANTFAEV
DOMAINcd669/858ASSVPQEGKSTTSTNLAITLAQSGARTLLIDCDLRRPTQNSVFGFPREPGLVNCLIGMAR
LDEAIRPSGIPNLDILSSGSIPPNPSELIGSRRMRELLNDLEKDYDMILIDSPPIGAVTD
AMILSTMTDTTILVVRAHKTKMEFLEKSREGLERVNTPLLGVVLNDFDVSQTYGSASYKY
YRYYRYYNYY
SITEWalker A676/678GKS
SITEWalker A'696/703LLIDCDLR
SITEWalker B776/782ILIDSPP
SITEY Cluster841/858YGSASYKYYRYYRYYNYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPCSGGWRLRTVVEQARTLRPRSNPRFPFSPILLPGYIALGAFFRMASNNNYPYGRDGANGSQLPSRSQQFSPARPQPYN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDMVRLQRTLRDVDEKKNRLQWLDYVGLLWRGKWIILACLLVMGSLAAWYTYSLPFIYESSLQILVNEKDQSIDLLNNRN
                 NRLQWLDYVGLLWRGKWIILACLLVMGSLAAWYTYSLPFIYESSLQILVNEKDQSIDLLNNRN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YWSNTDRELKKELQILTSRPIYEKAAQRLLTLRYTDTIRRKTVLPMLVAVEAKLGTASHNQSSQDRHARLIDEVVESLHK
YWSNTDRELKKELQILTSRPIYEKAAQRLLTLRYTDTIRRKTVLPMLVAVEAKLGTASHNQSSQDRHARLIDEVVESLHK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIEVKPSKDADIIQVITRAGDPLEAALVANTFAEVYIKDNKEQNSRKATQIRQFVADKMEKVRDSLAVIELRLKDYLESK
MIEVKPSKDADIIQVITRAGDPLEAALVANTFAEV                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NILGLDIQAHDLVQAKSKLENDASQTQIQISTLSRKLQEARQQYQAVDSGFATEFASGDWAYASQLQTQIASLKTQRGLM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSVPFDGASKLAYDQKVKTLTEQMEMLESQLAPVIARLKNSNVGTLLSTTKQGELPTAPLGNLRQQIFEDEIALQALRAQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAAINAARAQVNAQMSAVPQQQMDVGRLVREQSASAKMYEDMLDEYNKKVLEEQSVTSTARIFEDAQPVLKPVSPNRTAN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILTGCFLGLAIGVGIALLLAYSDTTVHSPDDLEKHGFTVLTAIPLIPEGMLNYEIISNDPLSVRLNGRASSHLITHIQPK


       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APISESYRSLRTAVQFAAIEEPVRKILVASSVPQEGKSTTSTNLAITLAQSGARTLLIDCDLRRPTQNSVFGFPREPGLV
                            ASSVPQEGKSTTSTNLAITLAQSGARTLLIDCDLRRPTQNSVFGFPREPGLV
                                   GKS                 LLIDCDLR                 
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NCLIGMARLDEAIRPSGIPNLDILSSGSIPPNPSELIGSRRMRELLNDLEKDYDMILIDSPPIGAVTDAMILSTMTDTTI
NCLIGMARLDEAIRPSGIPNLDILSSGSIPPNPSELIGSRRMRELLNDLEKDYDMILIDSPPIGAVTDAMILSTMTDTTI
                                                       ILIDSPP                  
       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVVRAHKTKMEFLEKSREGLERVNTPLLGVVLNDFDVSQTYGSASYKYYRYYRYYNYYGGMEEEESSRRKDRRAKAIANG
LVVRAHKTKMEFLEKSREGLERVNTPLLGVVLNDFDVSQTYGSASYKYYRYYRYYNYY                      
                                        YGSASYKYYRYYRYYNYY                      
       890 
....:....|.
EATEKQPRLHG


© 1998-2019