BYKdb

Annotate results for A0A136Q761

A0A136Q761 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A136Q761
DOMAINcd35/224TSSIKGEGKSTVTSNIANSYAFSQKRVLLVDCDMRNPTVHRVLELPNRKGLADLIMAGRE
GQDAGDYITHYGPYFDVLTAGHRPPNPTELLGSKRMEALIGLFSGQYDYVILDTPPVLLV
PDAIALHPYVDGILLVVRHGYTTKEVLEDCKKAWEVAGTKPSACILNAIPDMQKRYSYYG
YYDYEETQPA
SITEWalker A42/44GKS
SITEWalker A'62/69LLVDCDMR
SITEWalker B144/150VILDTPP
SITE-101/-143YITHYGPYFDVLTAGHRPPNPTELLGSKRMEALIGLFSGQYDY
SITEY Cluster210/218YSYYGYYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDIDYKKQALEAFNTIQTNIGFLGIDHDIRTIMVTSSIKGEGKSTVTSNIANSYAFSQKRVLLVDCDMRNPTVHRVLELP
                                  TSSIKGEGKSTVTSNIANSYAFSQKRVLLVDCDMRNPTVHRVLELP
                                         GKS                 LLVDCDMR           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRKGLADLIMAGREGQDAGDYITHYGPYFDVLTAGHRPPNPTELLGSKRMEALIGLFSGQYDYVILDTPPVLLVPDAIAL
NRKGLADLIMAGREGQDAGDYITHYGPYFDVLTAGHRPPNPTELLGSKRMEALIGLFSGQYDYVILDTPPVLLVPDAIAL
                                                               VILDTPP          
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HPYVDGILLVVRHGYTTKEVLEDCKKAWEVAGTKPSACILNAIPDMQKRYSYYGYYDYEETQPAKGRGKNRRQPVIKREE
HPYVDGILLVVRHGYTTKEVLEDCKKAWEVAGTKPSACILNAIPDMQKRYSYYGYYDYEETQPA                
                                                 YSYYGYYDY                      
       250       260       270       280       290      
....:....|....:....|....:....|....:....|....:....|....:.
RQEKDMYTSIAKEAKEPHSRKDIHGAEPAEPEFIRKANTSGQGFQRQADRTKRKLH


© 1998-2019