BYKdb

Annotate results for A0A137XJB2

A0A137XJB2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A137XJB2
DOMAINtad9/262DTIDLKELFFALIAQWKLIALCIILSLVFALLYLRATPDTYSVDALVQVEDSKGASAALL
GDLSQMIEQKSPAQSEIEILKSRLVLGSVIQALHLDLEIASENNTFSHRLLNKTDYETEY
SPKTVTFNDGEKFFNINQFDVPNSYLDKKLSLSFKNNNFRLVDPKTDEIVLTAPLNKLNQ
LKNQFGTWKVAIFTNDTFDANYFVQKNSLPAAVQAILSNYSVAERGKLTGILGLNYQGQD
KEHITKVLNAILAA
DOMAINcd538/726AGPAPEVGKSFISTNLATIFAQSDKKVLLIDADMRRGYMHKYFDVDIKPGLSEFLSNQVA
LDQVIHQTEVNGLDVITRGKSPTNPSEMLGSQKFKALLDELSQQYDHIIIDTPPILAVTD
GIIISQYAGVNLLIARYSKSQMKELELSLNRFEQAGVKVNGFILNDIQRTAGAGYSYNYA
YAYKANKED
SITEWalker A545/547GKS
SITEWalker A'565/572LLIDADMR
SITEWalker B645/651IIIDTPP
SITE-575/-579YMHKY
SITE-616/-618GKS
SITEY Cluster712/720YSYNYAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQNTNTEDTIDLKELFFALIAQWKLIALCIILSLVFALLYLRATPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSP
        DTIDLKELFFALIAQWKLIALCIILSLVFALLYLRATPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQSEIEILKSRLVLGSVIQALHLDLEIASENNTFSHRLLNKTDYETEYSPKTVTFNDGEKFFNINQFDVPNSYLDKKLSL
AQSEIEILKSRLVLGSVIQALHLDLEIASENNTFSHRLLNKTDYETEYSPKTVTFNDGEKFFNINQFDVPNSYLDKKLSL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFKNNNFRLVDPKTDEIVLTAPLNKLNQLKNQFGTWKVAIFTNDTFDANYFVQKNSLPAAVQAILSNYSVAERGKLTGIL
SFKNNNFRLVDPKTDEIVLTAPLNKLNQLKNQFGTWKVAIFTNDTFDANYFVQKNSLPAAVQAILSNYSVAERGKLTGIL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLNYQGQDKEHITKVLNAILAAYSAQNVERRSAETAQTLKFLDEQLPDLKKQLDDAERVFNKFRQQYNTVDVTKESELYL
GLNYQGQDKEHITKVLNAILAA                                                          

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQSITLETKKIELQQQQADLAAKYTAEHPAIREINAQITALDKQITQLNSTLKQLPDIQRQYLQLFREVEVKTQLYTALL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQILILSIFLGGFLGTLLALLRNMLRTGVKDSTQIEREFDLPVYAT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPRSPVQETRMSILKKKKSIPILAVKHSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPAPEVGKSFISTNLATIFAQS
                                                         AGPAPEVGKSFISTNLATIFAQS
                                                                GKS             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DKKVLLIDADMRRGYMHKYFDVDIKPGLSEFLSNQVALDQVIHQTEVNGLDVITRGKSPTNPSEMLGSQKFKALLDELSQ
DKKVLLIDADMRRGYMHKYFDVDIKPGLSEFLSNQVALDQVIHQTEVNGLDVITRGKSPTNPSEMLGSQKFKALLDELSQ
    LLIDADMR                                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYDHIIIDTPPILAVTDGIIISQYAGVNLLIARYSKSQMKELELSLNRFEQAGVKVNGFILNDIQRTAGAGYSYNYAYAY
QYDHIIIDTPPILAVTDGIIISQYAGVNLLIARYSKSQMKELELSLNRFEQAGVKVNGFILNDIQRTAGAGYSYNYAYAY
    IIIDTPP                                                            YSYNYAYAY
      
....:.
KANKED
KANKED

© 1998-2019