BYKdb

Annotate results for A0A139CI15

A0A139CI15 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A139CI15
DOMAINcd58/241TSSTPSEGKSITIANLAISMTQNGQEVIIIDTDLRKPMQHRFFKMTNFAGLSNILTNEIE
LKEGIRETGVERLKLVSSGSVPPNPSELLSSKKMTEVIEEVEELADIVLLDCPPIIAVSD
PMVIANKVDGVILVVASHETEDKALVKAKEMLDKVQANIIGTILTKYRVGESKGYYSGYY
HYYG
SITEWalker A65/67GKS
SITEWalker A'85/92IIIDTDLR
SITEWalker B165/171VLLDCPP
SITEY Cluster232/240YYSGYYHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEEVEVMSDETKRRVQSRDRELVVRHNPKSPLAESYRTLRTNIRFLSPDDPLQTIAMTSSTPSEGKSITIANLAISMTQN
                                                         TSSTPSEGKSITIANLAISMTQN
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQEVIIIDTDLRKPMQHRFFKMTNFAGLSNILTNEIELKEGIRETGVERLKLVSSGSVPPNPSELLSSKKMTEVIEEVEE
GQEVIIIDTDLRKPMQHRFFKMTNFAGLSNILTNEIELKEGIRETGVERLKLVSSGSVPPNPSELLSSKKMTEVIEEVEE
    IIIDTDLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LADIVLLDCPPIIAVSDPMVIANKVDGVILVVASHETEDKALVKAKEMLDKVQANIIGTILTKYRVGESKGYYSGYYHYY
LADIVLLDCPPIIAVSDPMVIANKVDGVILVVASHETEDKALVKAKEMLDKVQANIIGTILTKYRVGESKGYYSGYYHYY
    VLLDCPP                                                            YYSGYYHYY
 
.
G
G

© 1998-2019