BYKdb

Annotate results for A0A139MZ47

A0A139MZ47 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A139MZ47
DOMAINcd41/230SSVQPNEGKSTISINLSLAFARAGYRTLLIDADIRNSVMTGVFKSQRKVEGLTEVLSGNA
DISRALADTDYPNLDVFLSGQVSPNPTGLLQGKNFEVIMGVLREHYDYIVVDTPPIGMVI
DAAIIAQRCDGSFLVSASGAVSRKAVQKAKEQLEQTGTPFLGVVLNKYDVSGDRYGVYGA
YGNYGAYGKK
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADIR
SITEWalker B149/155IVVDTPP
SITE-146/-148YDY
SITEY Cluster215/227YGVYGAYGNYGAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MATLEIIKNKLAEMHQAEEYFNALSTNIQLSGSDIKVVAVSSVQPNEGKSTISINLSLAFARAGYRTLLIDADIRNSVMT
                                        SSVQPNEGKSTISINLSLAFARAGYRTLLIDADIRNSVMT
                                               GKS                 LLIDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVFKSQRKVEGLTEVLSGNADISRALADTDYPNLDVFLSGQVSPNPTGLLQGKNFEVIMGVLREHYDYIVVDTPPIGMVI
GVFKSQRKVEGLTEVLSGNADISRALADTDYPNLDVFLSGQVSPNPTGLLQGKNFEVIMGVLREHYDYIVVDTPPIGMVI
                                                                    IVVDTPP     
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DAAIIAQRCDGSFLVSASGAVSRKAVQKAKEQLEQTGTPFLGVVLNKYDVSGDRYGVYGAYGNYGAYGKKH
DAAIIAQRCDGSFLVSASGAVSRKAVQKAKEQLEQTGTPFLGVVLNKYDVSGDRYGVYGAYGNYGAYGKK 
                                                      YGVYGAYGNYGAY    
© 1998-2019