BYKdb

Annotate results for A0A139N761

A0A139N761 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A139N761
DOMAINcd41/230TSAQPGEGKSTTSVNLAISFARAGFRTLLIDTDTRNSVMSGTFKSNERYQGLTSFLSGNA
ELSDVICDTSIDNLMIIPAGQVPPNPTTLIQNDNFKAMIETVRGLYDYVVIDTPPLGLVV
DAAILAHHSDASLLVTKAGADKRRTITKLKEQLDQSGSIFLGVILNKYDIHLDKYGSYGS
YGGYGSYGSY
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDTDTR
SITEWalker B149/155VVIDTPP
SITE-146/-148YDY
SITEY Cluster215/230YGSYGSYGGYGSYGSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDTDTRNSVMS
                                        TSAQPGEGKSTTSVNLAISFARAGFRTLLIDTDTRNSVMS
                                               GKS                 LLIDTDTR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTTLIQNDNFKAMIETVRGLYDYVVIDTPPLGLVV
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTTLIQNDNFKAMIETVRGLYDYVVIDTPPLGLVV
                                                                    VVIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAAILAHHSDASLLVTKAGADKRRTITKLKEQLDQSGSIFLGVILNKYDIHLDKYGSYGSYGGYGSYGSYGKNTGKKLKS
DAAILAHHSDASLLVTKAGADKRRTITKLKEQLDQSGSIFLGVILNKYDIHLDKYGSYGSYGGYGSYGSY          
                                                      YGSYGSYGGYGSYGSY          
     
....:
KGMKE


© 1998-2019