BYKdb

Annotate results for A0A139PA78

A0A139PA78 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A139PA78
DOMAINcd41/230TSVTANEGKSTTATNLAAAFARTGHRTLLVDADIRNSVMSGVFKSQSKVSGLTDFLTGQA
ELQTILNDTDIDNLDVILAGPVSPNPTGLLQSRQFETLLANLRPRYDSIIVDTSPIGLVI
DAAIIAQKCDASLLVTEAGSVKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGSYGA
YGSYGNYGKS
SITE-228/-230GKS
SITEWalker A'68/75LLVDADIR
SITEWalker B149/155IIVDTSP
SITEY Cluster215/227YGSYGAYGSYGNY
SITEWalker A48/50GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MATLELVRKRRNLIKLTEEYYNALSTNVQLSGASIKLVEVTSVTANEGKSTTATNLAAAFARTGHRTLLVDADIRNSVMS
                                        TSVTANEGKSTTATNLAAAFARTGHRTLLVDADIRNSVMS
                                               GKS                 LLVDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVFKSQSKVSGLTDFLTGQAELQTILNDTDIDNLDVILAGPVSPNPTGLLQSRQFETLLANLRPRYDSIIVDTSPIGLVI
GVFKSQSKVSGLTDFLTGQAELQTILNDTDIDNLDVILAGPVSPNPTGLLQSRQFETLLANLRPRYDSIIVDTSPIGLVI
                                                                    IIVDTSP     
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DAAIIAQKCDASLLVTEAGSVKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGSYGAYGSYGNYGKSN
DAAIIAQKCDASLLVTEAGSVKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGSYGAYGSYGNYGKS 
                                                      YGSYGAYGSYGNY    
© 1998-2019