BYKdb

Annotate results for A0A139SPN4

A0A139SPN4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A139SPN4
DOMAINtad5/161QSRSLRDYYVILRERFWIALPLALLVALGIGYYQARQTPMYASTAIIQFERPETIVTTQG
VVDASIRNEIDLNTYIHQLTSNRVRTRVLESLTPEEIAIIQRPYLKSQPPGEPLPPLAAM
LGLLSIDPVRNSFILRLTVGHQDPEAAAILAQRHVDQ
DOMAINcd504/700TSTIPGEGKTLVSANLAASFARHGKRTLLVDCDLRRPMLHRRFDLANTSGLIPFYESGAS
LDTDLSTDPTLGIVKLNENLSLLRSGGRSRRPTELLESDLFGDLLKKLGRYYDLIVIDSP
PLGAVTDGLLIAERVDEVAYVCRFNRAHRKHIQLYMRALRNAKTEILGVILNGLAPRRVE
YYSNYRYYRSYGKYTNV
SITEWalker A511/513GKT
SITEWalker A'531/538LLVDCDLR
SITEWalker B618/624IVIDSPP
SITE-614/-615YY
SITEY Cluster684/697YYSNYRYYRSYGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPAGQSRSLRDYYVILRERFWIALPLALLVALGIGYYQARQTPMYASTAIIQFERPETIVTTQGVVDASIRNEIDLNTYI
    QSRSLRDYYVILRERFWIALPLALLVALGIGYYQARQTPMYASTAIIQFERPETIVTTQGVVDASIRNEIDLNTYI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HQLTSNRVRTRVLESLTPEEIAIIQRPYLKSQPPGEPLPPLAAMLGLLSIDPVRNSFILRLTVGHQDPEAAAILAQRHVD
HQLTSNRVRTRVLESLTPEEIAIIQRPYLKSQPPGEPLPPLAAMLGLLSIDPVRNSFILRLTVGHQDPEAAAILAQRHVD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFLSYLLDNISGVNDTALDFLHERAEQLRLESEAKAQKQQEYMEKNNLISLDSSTSIVDNRLLTINGALTAARLRLLEVE
Q                                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIAKQVADYQESGDNLLEITYIGSYGTVAPLRTQLSTLLQEQARLAERYLERHPRMIETTNAIITTQEHLDFAVQGAIAD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHASLTEVNKTISQLETEYTAAEQEALNLRNMRVDFESLQNEALVARSNYMQILDRLNQTTTTKYLEKVPIRLLDRAQVA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SHPYTPNFPKIIRVCVMMFLVVFFGTAFGLDFIDDRIKSAWDIENFLNTSLLGIVPDLNNVKDEDKYTLLLKDTNPTAVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFTGIYSAAKTHSLVDYPKAMLVTSTIPGEGKTLVSANLAASFARHGKRTLLVDCDLRRPMLHRRFDLANTSGLIPFYES
                       TSTIPGEGKTLVSANLAASFARHGKRTLLVDCDLRRPMLHRRFDLANTSGLIPFYES
                              GKT                 LLVDCDLR                      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GASLDTDLSTDPTLGIVKLNENLSLLRSGGRSRRPTELLESDLFGDLLKKLGRYYDLIVIDSPPLGAVTDGLLIAERVDE
GASLDTDLSTDPTLGIVKLNENLSLLRSGGRSRRPTELLESDLFGDLLKKLGRYYDLIVIDSPPLGAVTDGLLIAERVDE
                                                         IVIDSPP                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAYVCRFNRAHRKHIQLYMRALRNAKTEILGVILNGLAPRRVEYYSNYRYYRSYGKYTNVEPARGELDREPARAPEAAPA
VAYVCRFNRAHRKHIQLYMRALRNAKTEILGVILNGLAPRRVEYYSNYRYYRSYGKYTNV                    
                                           YYSNYRYYRSYGKY                       
       
....:..
AEPAVAA


© 1998-2019