BYKdb

Annotate results for A0A139SU05

A0A139SU05 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A139SU05
DOMAINtad30/186QRRSLRDYYVILRERFWIALPLALLVSLVIGYYQARQTPMYASTAIIQFERPETVVTTQT
VMDATIRNELDLNTYIHQLTSNRVRTRVLESLTPEEVAIIQRPYLKSQAPGEPLPPLAAM
LGLLSIDPVRNSFILRLTVGHQDPEAAAILAQRHVDQ
DOMAINcd529/725TSTIPGEGKTLVSANLAASFARHGKRTLLVDCDLRRPMLHRRFDLANTSGIIAFYEADGD
LDCDLPNDSTLGIVKLSENLSLLRSGGRSRRPTELLESPFFGDLLQKLGHYYDLIIIDSP
PLGAVTDGLLIAERVDEVAYVCRFNRAHRKHIQLYMRALRNAKTEVLGVVLNGLTPRRVE
YYSNYRYYRSYGKYTER
SITEWalker A536/538GKT
SITEWalker A'556/563LLVDCDLR
SITEWalker B643/649IIIDSPP
SITE-639/-640YY
SITEY Cluster709/722YYSNYRYYRSYGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAEPAGSSPTPPVPLGAAPSSSAADAPVEQRRSLRDYYVILRERFWIALPLALLVSLVIGYYQARQTPMYASTAIIQFER
                             QRRSLRDYYVILRERFWIALPLALLVSLVIGYYQARQTPMYASTAIIQFER

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PETVVTTQTVMDATIRNELDLNTYIHQLTSNRVRTRVLESLTPEEVAIIQRPYLKSQAPGEPLPPLAAMLGLLSIDPVRN
PETVVTTQTVMDATIRNELDLNTYIHQLTSNRVRTRVLESLTPEEVAIIQRPYLKSQAPGEPLPPLAAMLGLLSIDPVRN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFILRLTVGHQDPEAAAILAQRHVDQFLSYLLENISGVNDTAVDFLRERAEQLRLESEAKAQRQQEYMQRHNLISLDNST
SFILRLTVGHQDPEAAAILAQRHVDQ                                                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIVDSRLLAVNGSLTQARLRLLEVESLAKQVDDYQEAGANLLEITYIGNYNTVAPLRGQMTTLLQEQARLAERYLERHPR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIEVTNAIIITQEHLDLAVQGAIADLKTSLIEVKKTIAQLENEYAENEKEALSLRNMRVDFESLQNEAAVARANYMQILD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLNQTTTTKYLEKVPIRLLDRAQVSGRPYTPNFPKIVRMCVMMFCVVFFGTAFGLDFIDDRIKSAWDIENFLGTSLLGIV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDLASVKDEDKYTLLLKDTHPTAVEAFMGIYGAAKTHSLVDYPKSMLVTSTIPGEGKTLVSANLAASFARHGKRTLLVDC
                                                TSTIPGEGKTLVSANLAASFARHGKRTLLVDC
                                                       GKT                 LLVDC
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRRPMLHRRFDLANTSGIIAFYEADGDLDCDLPNDSTLGIVKLSENLSLLRSGGRSRRPTELLESPFFGDLLQKLGHYY
DLRRPMLHRRFDLANTSGIIAFYEADGDLDCDLPNDSTLGIVKLSENLSLLRSGGRSRRPTELLESPFFGDLLQKLGHYY
DLR                                                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLIIIDSPPLGAVTDGLLIAERVDEVAYVCRFNRAHRKHIQLYMRALRNAKTEVLGVVLNGLTPRRVEYYSNYRYYRSYG
DLIIIDSPPLGAVTDGLLIAERVDEVAYVCRFNRAHRKHIQLYMRALRNAKTEVLGVVLNGLTPRRVEYYSNYRYYRSYG
  IIIDSPP                                                           YYSNYRYYRSYG
       730       740         
....:....|....:....|....:....
KYTERVDRPERETKRPKKVVEEAEVSEIA
KYTER                        
KY                           

© 1998-2019