BYKdb

Annotate results for A0A139TLN4

A0A139TLN4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A139TLN4
DOMAINtad21/263LFPSPRALLARIIRNWYWCLLSLCICLPLAYLYAARLPFVYGKATTVLIKNDYPKESVAT
TVLATSNGIVNTASTNLDNEIFLLSSYSLMEEVVRKLKLDVTYWKKSGFRKEEIYDRSPI
AVHFSERGNPAEAGFRVIPVSDTEFRLESGVNDSRPERETGVFGREIEFCSHTFTVEKTP
RFDSRSLDAPVIVRKTFIKNAAIALIGGLTVNKASGKTNLINISVRCNNPVKAENVLHNL
VRF
DOMAINcd601/791TSSCPGEGKTYLAVNLALSLAVAGKKVLLMDMDLRKGTLSSLLGGEGKPGTGDLDRVGEG
GWRSLLEKSSVSDHLDYLFAGTLPDHPSRLLLHDRVRELMKELKEHYDFIFMDCVPYASL
ADARIAARLADATLYVMRAGCVKKRDLSSLQKTWKSGELKRMGIVLCDVENRSRPSRKYA
MYRSFDTSSPC
SITEWalker A608/610GKT
SITEWalker A'628/635LLMDMDLR
SITEWalker B710/716IFMDCVP
SITEY Cluster779/782YAMY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKSSSPKPDSLETEGGASVSLFPSPRALLARIIRNWYWCLLSLCICLPLAYLYAARLPFVYGKATTVLIKNDYPKESVAT
                    LFPSPRALLARIIRNWYWCLLSLCICLPLAYLYAARLPFVYGKATTVLIKNDYPKESVAT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVLATSNGIVNTASTNLDNEIFLLSSYSLMEEVVRKLKLDVTYWKKSGFRKEEIYDRSPIAVHFSERGNPAEAGFRVIPV
TVLATSNGIVNTASTNLDNEIFLLSSYSLMEEVVRKLKLDVTYWKKSGFRKEEIYDRSPIAVHFSERGNPAEAGFRVIPV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDTEFRLESGVNDSRPERETGVFGREIEFCSHTFTVEKTPRFDSRSLDAPVIVRKTFIKNAAIALIGGLTVNKASGKTNL
SDTEFRLESGVNDSRPERETGVFGREIEFCSHTFTVEKTPRFDSRSLDAPVIVRKTFIKNAAIALIGGLTVNKASGKTNL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INISVRCNNPVKAENVLHNLVRFYNEASLDEKKKRGMNTDKFIEERLGVINEEMGENDLAIENLKKESNILTDLSTALTE
INISVRCNNPVKAENVLHNLVRF                                                         

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYENSLNDKKDLRELTLEIKSIEYLKEYLEKEAEFDSRLVPINSKIADMGIRDQIGVFNDTLLKKTSLKVNAGDNNPIVR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELEANLASLKDALKRSVNNYYTSLLVKKKNVEEQHEGTRAHIRAVSGKERAVNQIAREQRVRESLYIFLLNKREENSLAL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AATEDNARIVDAVRGGDGPLAPNVPKILLVGFLVGLAVPVLGCVIAAMMDSRVKRREEIESLTDIPVYGVLPRKPRKLKN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEIVVNLEEPSELSESFPLLAERLVSLADENGPGGFSILLTSSCPGEGKTYLAVNLALSLAVAGKKVLLMDMDLRKGTLS
                                        TSSCPGEGKTYLAVNLALSLAVAGKKVLLMDMDLRKGTLS
                                               GKT                 LLMDMDLR     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLLGGEGKPGTGDLDRVGEGGWRSLLEKSSVSDHLDYLFAGTLPDHPSRLLLHDRVRELMKELKEHYDFIFMDCVPYASL
SLLGGEGKPGTGDLDRVGEGGWRSLLEKSSVSDHLDYLFAGTLPDHPSRLLLHDRVRELMKELKEHYDFIFMDCVPYASL
                                                                     IFMDCVP    
       730       740       750       760       770       780       790    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
ADARIAARLADATLYVMRAGCVKKRDLSSLQKTWKSGELKRMGIVLCDVENRSRPSRKYAMYRSFDTSSPCPGK
ADARIAARLADATLYVMRAGCVKKRDLSSLQKTWKSGELKRMGIVLCDVENRSRPSRKYAMYRSFDTSSPC   
                                                          YAMY            

© 1998-2019