BYKdb

Annotate results for A0A139TUL1

A0A139TUL1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A139TUL1
DOMAINtad12/254DIFSFRFIFSTARRYWLWILAAALLGGAGAYFIFARQGYLYEKTARIMLRDDKQKNSQVS
EIILSDLGVRAGEANLANESYVVQSSEVMGRVVKGLELGVSYWEKRNIRKVELYHTTPLK
VEFGEEVDFQPCSLAVTPLNGREFSLSYREKGGRETALAGKFGIPLELPFATVTVRTTSH
FSSGSIGRPIFVERLSVKEACAQMLGRLSVTRPDSKESSLLELTLRLSHPQKAEDVLNYL
IEV
DOMAINcd592/779TSTRTGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFCVGKNSRGLAHLLMNPLA
SPDSVLQSGENFPGFDMVPAGPVPPNPAALLTQGRFEDLIRYWRTRYDRIIVDGCPYEAV
ADASLMARHADLVLYLIRCGMIEKQYVPSIQEVAARGEFRSVALILNAENFKNSRFHYYS
EYSGSETA
SITEWalker A599/601GKT
SITEWalker A'619/626LLIDGDLR
SITEWalker B701/707IIVDGCP
SITE-693/-698YWRTRY
SITEY Cluster769/773YYSEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSIPVIQPEDNDIFSFRFIFSTARRYWLWILAAALLGGAGAYFIFARQGYLYEKTARIMLRDDKQKNSQVSEIILSDLGV
           DIFSFRFIFSTARRYWLWILAAALLGGAGAYFIFARQGYLYEKTARIMLRDDKQKNSQVSEIILSDLGV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAGEANLANESYVVQSSEVMGRVVKGLELGVSYWEKRNIRKVELYHTTPLKVEFGEEVDFQPCSLAVTPLNGREFSLSYR
RAGEANLANESYVVQSSEVMGRVVKGLELGVSYWEKRNIRKVELYHTTPLKVEFGEEVDFQPCSLAVTPLNGREFSLSYR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKGGRETALAGKFGIPLELPFATVTVRTTSHFSSGSIGRPIFVERLSVKEACAQMLGRLSVTRPDSKESSLLELTLRLSH
EKGGRETALAGKFGIPLELPFATVTVRTTSHFSSGSIGRPIFVERLSVKEACAQMLGRLSVTRPDSKESSLLELTLRLSH

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQKAEDVLNYLIEVYNDHSRREKQIASTRAEDFIVKRIEKLGGQLGGVDKQVIDYKRHSRIVKDMSTTLEATFSKLQEIG
PQKAEDVLNYLIEV                                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELFSTRTELIQVKVLAGLLAEGGRERDMIPANIGIQDAGIAKQIELFNDNFLQYKKLSASAGKQNPMVSSLAENMKEMR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESIVRSISNYCDVLRVRMGELERERDELNRGLSDMASKDEGLVPLLREQKVMEELYLMLLKKREENALALATTEPSARIL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPAFGSNSPVAPKLPLMTLGGMAGGAFLCLLSLMVSNALNTNVKDKNDLVGLVSLPLAGELPLLSGKERKKLPLVVINSR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFMEECFHILRNNTELLLLPNPEKASRVVFLTSTRTGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFCVGKNSR
                               TSTRTGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFCVGKNSR
                                      GKT                 LLIDGDLR              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLAHLLMNPLASPDSVLQSGENFPGFDMVPAGPVPPNPAALLTQGRFEDLIRYWRTRYDRIIVDGCPYEAVADASLMARH
GLAHLLMNPLASPDSVLQSGENFPGFDMVPAGPVPPNPAALLTQGRFEDLIRYWRTRYDRIIVDGCPYEAVADASLMARH
                                                            IIVDGCP             
       730       740       750       760       770       780
....:....|....:....|....:....|....:....|....:....|....:....|
ADLVLYLIRCGMIEKQYVPSIQEVAARGEFRSVALILNAENFKNSRFHYYSEYSGSETAG
ADLVLYLIRCGMIEKQYVPSIQEVAARGEFRSVALILNAENFKNSRFHYYSEYSGSETA 
                                                YYSEY       

© 1998-2019