BYKdb

Annotate results for A0A139WSU3

A0A139WSU3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A139WSU3
DOMAINtad1/145MNKLVTISTKHWKSLIAFNVLVVLATAVAVSNAKPVWIAKTQLILPKTTSNLDANLGTLG
SLRNGDSAFSSEVNPLNVQASILTSDTLLEKVLASDPERGKFNSISRYRQLFKVTPQEQS
TIMLLTVSGSSPKLANQRAIAITEA
DOMAINcd501/676TSATQGEGKTTVAIGLAYGLVDLGFRVLLVDGDFRSAELSRSLGYAEDSTIEQLQRSIQP
NLDLLPTLPKRGKIVETIKRGRFEQALTACEARGNYDYVIVDSAPVSLTSETALMATLIS
NVLFVVRPDSSYKNSVNESFAQLSQHNVEILGLVVNAVESKKKPYSYHSDSSLVNT
SITEWalker A508/510GKT
SITEWalker A'528/535LLVDGDFR
SITEWalker B599/605VIVDSAP
SITE-596/-598YDY
SITEY Cluster665/667YSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKLVTISTKHWKSLIAFNVLVVLATAVAVSNAKPVWIAKTQLILPKTTSNLDANLGTLGSLRNGDSAFSSEVNPLNVQA
MNKLVTISTKHWKSLIAFNVLVVLATAVAVSNAKPVWIAKTQLILPKTTSNLDANLGTLGSLRNGDSAFSSEVNPLNVQA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SILTSDTLLEKVLASDPERGKFNSISRYRQLFKVTPQEQSTIMLLTVSGSSPKLANQRAIAITEAYQNRLNELRQANSRT
SILTSDTLLEKVLASDPERGKFNSISRYRQLFKVTPQEQSTIMLLTVSGSSPKLANQRAIAITEA               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQKFSQIELEQAKLKLAQAQSKLTIFKQSSGLINNEDQAKGIVDSISTLTTVRAQVLATAEASENRAKALSIRLSLTPNE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIRSLGLGENKEYQFVRQQLSEVEASLRQKQAIFTDVHPEVKTLLAQRESLQRKIQEHIRQTSAGTKVDTTVATDSQGRA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALIQQQVLAESEATAQRRQAQQLNNQITQLQTTLKSFPVNQARLVELQRQVDVTEGVYKGLIAQIQQSNIDAFDAYPNIQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDAPQVDPKPVSPKFLLMAVNALLASIIGSIALVLFLESRNPLLNLKDLQGQKFAIVQSIPRIKHSDPKIEMTSVSEVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FQRLASAISLQPLNNRRLLVTSATQGEGKTTVAIGLAYGLVDLGFRVLLVDGDFRSAELSRSLGYAEDSTIEQLQRSIQP
                    TSATQGEGKTTVAIGLAYGLVDLGFRVLLVDGDFRSAELSRSLGYAEDSTIEQLQRSIQP
                           GKT                 LLVDGDFR                         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLDLLPTLPKRGKIVETIKRGRFEQALTACEARGNYDYVIVDSAPVSLTSETALMATLISNVLFVVRPDSSYKNSVNESF
NLDLLPTLPKRGKIVETIKRGRFEQALTACEARGNYDYVIVDSAPVSLTSETALMATLISNVLFVVRPDSSYKNSVNESF
                                      VIVDSAP                                   
       650       660       670      
....:....|....:....|....:....|....:.
AQLSQHNVEILGLVVNAVESKKKPYSYHSDSSLVNT
AQLSQHNVEILGLVVNAVESKKKPYSYHSDSSLVNT
                        YSY         
© 1998-2019