BYKdb

Annotate results for A0A140D6X9

A0A140D6X9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A140D6X9
DOMAINtad8/245ETLDVMKFLGILLDHKGWIALFTLLTTLIGAGYAFLAPPVYLANASIQIEDKSAGGALKD
FAGIFEEKSSSHTEIAILKSRMVLSYTVEKLDLTTQVEPIYPVPILGKLFASTTGYSPQI
TISHFTPLNEAANTLILEIGEQRDSYTLFLEKTTEPLLTGKVGEKYDTDLIQFSLSQINA
KPKQRFLINKLPELTVISALQEQLSVHEIGKQTGIINIAIQGKDKKHIQDIVSSIAES
DOMAINcd520/699SGTLPSVGKSFISSNLANVLAKTGKRVLLIDADLRRSYLRPFLGIAKKQGLSEAIAQNIP
FEDIVHQYAEFAIITKGNTPPNPSELFYTARFQQLLEWASSHYDLVVIDTPPILPVTDAA
IIGRYVGTTLLVGLFGKTTVKEIEIAKTRFAQAGVPVKGFILNGTKRKALSYYDYYNYRS
SITE-655/-657GKT
SITEWalker A'547/554LLIDADLR
SITEWalker B625/631VVIDTPP
SITEY Cluster691/697YYDYYNY
SITEWalker A527/529GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNEKNHEETLDVMKFLGILLDHKGWIALFTLLTTLIGAGYAFLAPPVYLANASIQIEDKSAGGALKDFAGIFEEKSSSHT
       ETLDVMKFLGILLDHKGWIALFTLLTTLIGAGYAFLAPPVYLANASIQIEDKSAGGALKDFAGIFEEKSSSHT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIAILKSRMVLSYTVEKLDLTTQVEPIYPVPILGKLFASTTGYSPQITISHFTPLNEAANTLILEIGEQRDSYTLFLEKT
EIAILKSRMVLSYTVEKLDLTTQVEPIYPVPILGKLFASTTGYSPQITISHFTPLNEAANTLILEIGEQRDSYTLFLEKT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEPLLTGKVGEKYDTDLIQFSLSQINAKPKQRFLINKLPELTVISALQEQLSVHEIGKQTGIINIAIQGKDKKHIQDIVS
TEPLLTGKVGEKYDTDLIQFSLSQINAKPKQRFLINKLPELTVISALQEQLSVHEIGKQTGIINIAIQGKDKKHIQDIVS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIAESYLLQNVARNSAEASKSLEFLNQQLPDVRQKLSDSENRLNEFRLKNESVDLSLEAKATLDTIIQIEADLSELSIQE
SIAES                                                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEISRKFTLKHPSYVALIDKRNVLNAEKERLNKQLEKLPNTQKEMIRFTRDLEVNQHIYIQLLNKMQELDVVKASTIGNV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RILDHAQVFPNPVAPKKALVIILAFLLGGLLSSFLVLFRNYFQRGIESTADVDKTGLPTYAAIPHSEQQPAISRKPVHKG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KYRLLSESHPEDNTIEAVRSLRTSLHFAMLEAPNNLVMISGTLPSVGKSFISSNLANVLAKTGKRVLLIDADLRRSYLRP
                                       SGTLPSVGKSFISSNLANVLAKTGKRVLLIDADLRRSYLRP
                                              GKS                 LLIDADLR      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FLGIAKKQGLSEAIAQNIPFEDIVHQYAEFAIITKGNTPPNPSELFYTARFQQLLEWASSHYDLVVIDTPPILPVTDAAI
FLGIAKKQGLSEAIAQNIPFEDIVHQYAEFAIITKGNTPPNPSELFYTARFQQLLEWASSHYDLVVIDTPPILPVTDAAI
                                                                VVIDTPP         
       650       660       670       680       690         
....:....|....:....|....:....|....:....|....:....|....:....
IGRYVGTTLLVGLFGKTTVKEIEIAKTRFAQAGVPVKGFILNGTKRKALSYYDYYNYRS
IGRYVGTTLLVGLFGKTTVKEIEIAKTRFAQAGVPVKGFILNGTKRKALSYYDYYNYRS
                                                  YYDYYNY  
© 1998-2019