BYKdb

Annotate results for A0A140DXM2

A0A140DXM2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A140DXM2
DOMAINcd50/243LSTHPNEGKSSVASNLAKIFADKYEKVLLIDCDLRTPSLHKMLRTSNGEGLTNLLTHYRQ
DDPLLEQDEIQELELDDQSSLFFLSAGSRVPNPTEIISSRRFASLINSARSQFDQVIIDC
PPAFAVSDAVPISNLSDGTLFVLSAKETDKNDAREAVDDLKRNGANLIGTVMTKVPGFMS
RHYYGYGYGDRNER
SITEWalker A57/59GKS
SITEWalker A'77/84LLIDCDLR
SITEWalker B165/171VIIDCPP
SITEY Cluster232/237YYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKKKNVSNNSSRRTNRNDQLNLEEVYRQLRTNIEFSQMDSELRVLNVLSTHPNEGKSSVASNLAKIFADKYEKVLLID
                                                 LSTHPNEGKSSVASNLAKIFADKYEKVLLID
                                                        GKS                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CDLRTPSLHKMLRTSNGEGLTNLLTHYRQDDPLLEQDEIQELELDDQSSLFFLSAGSRVPNPTEIISSRRFASLINSARS
CDLRTPSLHKMLRTSNGEGLTNLLTHYRQDDPLLEQDEIQELELDDQSSLFFLSAGSRVPNPTEIISSRRFASLINSARS
CDLR                                                                            
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFDQVIIDCPPAFAVSDAVPISNLSDGTLFVLSAKETDKNDAREAVDDLKRNGANLIGTVMTKVPGFMSRHYYGYGYGDR
QFDQVIIDCPPAFAVSDAVPISNLSDGTLFVLSAKETDKNDAREAVDDLKRNGANLIGTVMTKVPGFMSRHYYGYGYGDR
    VIIDCPP                                                            YYGYGY   
   
...
NER
NER

© 1998-2019