BYKdb

Annotate results for A0A140K3H3

A0A140K3H3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A140K3H3
DOMAINtad20/169SAFSLTELKQTLSRQWKPALLVASTVCAGIFLSTVLQNPKYQSQTLILLENQKTQQSASV
SPEQQSLATGYYNLKDLSTEVLVLRSYPLIAKAVKQVQQKYGDLTVTDVMENLSITQAAV
NEMPTDVLVVSYTDTNPERAKAVLDALGST
DOMAINcd584/771TSATSAEGKTTVTYNLGIVLAELGLNVLIIDADMRKPKIHKLAKLPNDEGLSEAITTERP
WTDFVQIGVVENLHLITSGSTSPNPIALLNSDKMKQLLQQWQEAYDYVLVDTPPIGVVAD
AKSLANQVDSVLFVVGIEKATRRAINNSLEILRNSQCNIAGFTANLVDREFDYYSYSYYD
SYYNQSTN
SITEWalker A591/593GKT
SITEWalker A'611/618LIIDADMR
SITEWalker B691/697VLVDTPP
SITE-688/-690YDY
SITEY Cluster756/766YYSYSYYDSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNNQLVNPNSLYLPTPETESAFSLTELKQTLSRQWKPALLVASTVCAGIFLSTVLQNPKYQSQTLILLENQKTQQSASVS
                   SAFSLTELKQTLSRQWKPALLVASTVCAGIFLSTVLQNPKYQSQTLILLENQKTQQSASVS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PEQQSLATGYYNLKDLSTEVLVLRSYPLIAKAVKQVQQKYGDLTVTDVMENLSITQAAVNEMPTDVLVVSYTDTNPERAK
PEQQSLATGYYNLKDLSTEVLVLRSYPLIAKAVKQVQQKYGDLTVTDVMENLSITQAAVNEMPTDVLVVSYTDTNPERAK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVLDALGSTYVEYSLNRQRSQAGNAINFIDEQLPKAQAELNEVAKAIRNFRQTYNIVDPDEYALRVIQFRDGLEQQEKQA
AVLDALGST                                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIALARTQRQYQEINRQLRDLGQNPETIVAYTLLSQDQVYQSLASQLKELETQYALGSVNFYDSYHVMEDIKLKQAELRT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LMQERSQQILGDAVSQVNLEAIIVSQGSTSQVMGINGADTQAQALNPGQPVDSQGASTQVSGTISTIQSLASMRSQVETE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAALQSQIAGIQQAKTKVEKTFKQIPQLQQYYAEVKRQFDIKSKAVDYLMQRRQELYIEQAQENAPWQILEAPPLPSIPI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPNLERGILLALVAGSLMGVATAFLLQKLDQRVKQVEEVKQMVRLPLLGTIPKVEKPLIQVNGETNTKAHYYNYSSFTEG


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRTLAMNLRYTLTEKGKINSLALTSATSAEGKTTVTYNLGIVLAELGLNVLIIDADMRKPKIHKLAKLPNDEGLSEAITT
                       TSATSAEGKTTVTYNLGIVLAELGLNVLIIDADMRKPKIHKLAKLPNDEGLSEAITT
                              GKT                 LIIDADMR                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERPWTDFVQIGVVENLHLITSGSTSPNPIALLNSDKMKQLLQQWQEAYDYVLVDTPPIGVVADAKSLANQVDSVLFVVGI
ERPWTDFVQIGVVENLHLITSGSTSPNPIALLNSDKMKQLLQQWQEAYDYVLVDTPPIGVVADAKSLANQVDSVLFVVGI
                                                  VLVDTPP                       
       730       740       750       760       770       780       790        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
EKATRRAINNSLEILRNSQCNIAGFTANLVDREFDYYSYSYYDSYYNQSTNGNGNGNGNGHHSEGRMQQLLQQFRRRE
EKATRRAINNSLEILRNSQCNIAGFTANLVDREFDYYSYSYYDSYYNQSTN                           
                                   YYSYSYYDSYY                                

© 1998-2019