BYKdb

Annotate results for A0A140LCR7

A0A140LCR7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A140LCR7
DOMAINcd44/229TSSMPQEGKSTVAANLAVSIASTRSKVLLVDADLRRPKLYKLFRLENYKGLSNFLAEDLP
LESVITKMANLHIITSGPIPPNPAEILGSSKMKKFLDEMATKYDMILLDAPPVNSVADAA
ILSTLVDGVILVVETGVTAREAAIAAKQQLEKVNAKILGVVLNKIKQDKNGGYYYYYYYY
GEEGTK
SITEWalker A51/53GKS
SITEWalker A'71/78LLVDADLR
SITEWalker B149/155ILLDAPP
SITEY Cluster216/223YYYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEERELELFIMNDPKSVISEAFRVLRTNLQFSSIDKPVKKVVVTSSMPQEGKSTVAANLAVSIASTRSKVLLVDADLRRP
                                           TSSMPQEGKSTVAANLAVSIASTRSKVLLVDADLRRP
                                                  GKS                 LLVDADLR  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLYKLFRLENYKGLSNFLAEDLPLESVITKMANLHIITSGPIPPNPAEILGSSKMKKFLDEMATKYDMILLDAPPVNSVA
KLYKLFRLENYKGLSNFLAEDLPLESVITKMANLHIITSGPIPPNPAEILGSSKMKKFLDEMATKYDMILLDAPPVNSVA
                                                                    ILLDAPP     
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
DAAILSTLVDGVILVVETGVTAREAAIAAKQQLEKVNAKILGVVLNKIKQDKNGGYYYYYYYYGEEGTKKRKKKR
DAAILSTLVDGVILVVETGVTAREAAIAAKQQLEKVNAKILGVVLNKIKQDKNGGYYYYYYYYGEEGTK      
                                                       YYYYYYYY            
© 1998-2019