BYKdb

Annotate results for A0A140NMZ0

A0A140NMZ0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A140NMZ0
DOMAINtad12/242DEIDLLALFKILKSSYLKIGFFTLFFIVIGAAYSFLATPIYQANATLQYDKMSQVSLLDQ
MSDVMPFANNNSQADSEIEVIKSRMVLGKTVADLNLDIHTAPAGFFDRLWGDKASVLISL
YSLPEHLIGEPAILTYLGENRYALHIDNQTVEGKVGELLKQDEISLLVSSINAEAGQEFT
LSKDARYSTIENLRNTLTIAEVGKGTGIINLAIKGTDKAENVQILNSIIQN
DOMAINcd513/692SSASPGVGKSFVTSNMAVVLANAGKKVLLIDTDLRKGRIHKAFGLSNKTGLSEYLAQQDI
TQPTIHHGVIENLDVICRGKNVTHSSELLMGERFKHLLDTVKGQYDIVVIDTAPILAITD
SAIIGKYVGTSLLIAYYGVNTVKDIELSLKRFKQNDIEITGVILNGIDAKSDDYNYVYEY
SITEWalker A520/522GKS
SITEWalker A'540/547LLIDTDLR
SITEWalker B620/626VVIDTAP
SITE-648/-649YY
SITEY Cluster686/692YNYVYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNTTKTSSAASDEIDLLALFKILKSSYLKIGFFTLFFIVIGAAYSFLATPIYQANATLQYDKMSQVSLLDQMSDVMPFAN
           DEIDLLALFKILKSSYLKIGFFTLFFIVIGAAYSFLATPIYQANATLQYDKMSQVSLLDQMSDVMPFAN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNSQADSEIEVIKSRMVLGKTVADLNLDIHTAPAGFFDRLWGDKASVLISLYSLPEHLIGEPAILTYLGENRYALHIDNQ
NNSQADSEIEVIKSRMVLGKTVADLNLDIHTAPAGFFDRLWGDKASVLISLYSLPEHLIGEPAILTYLGENRYALHIDNQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVEGKVGELLKQDEISLLVSSINAEAGQEFTLSKDARYSTIENLRNTLTIAEVGKGTGIINLAIKGTDKAENVQILNSII
TVEGKVGELLKQDEISLLVSSINAEAGQEFTLSKDARYSTIENLRNTLTIAEVGKGTGIINLAIKGTDKAENVQILNSII

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QNYVDQNTERKKEVTNNTLLFLDEYLPKVKTKLDNYENQLNAFRKKNESIDLSLEAKSALDSALQVEEKLNELTFKEVEI
QN                                                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQLYTRNHPAYQSLLDKRQQLLREKEKISKNIQKLPNTQQQIVRLTRDVESEQAIYNQLVAKQQELSVLNSGITADVRII


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSAESQPNAVAPKKSLILVLATILGFIVGCAYVIAREFFNNKIKGTEDIDALGVNVYATIPFSNYEKKLIAAGNKRPLAL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENPADTAVEAIRSLRTSVYFSVMNQGNNLVMISSASPGVGKSFVTSNMAVVLANAGKKVLLIDTDLRKGRIHKAFGLSNK
                                SSASPGVGKSFVTSNMAVVLANAGKKVLLIDTDLRKGRIHKAFGLSNK
                                       GKS                 LLIDTDLR             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGLSEYLAQQDITQPTIHHGVIENLDVICRGKNVTHSSELLMGERFKHLLDTVKGQYDIVVIDTAPILAITDSAIIGKYV
TGLSEYLAQQDITQPTIHHGVIENLDVICRGKNVTHSSELLMGERFKHLLDTVKGQYDIVVIDTAPILAITDSAIIGKYV
                                                           VVIDTAP              
       650       660       670       680       690  
....:....|....:....|....:....|....:....|....:....|..
GTSLLIAYYGVNTVKDIELSLKRFKQNDIEITGVILNGIDAKSDDYNYVYEY
GTSLLIAYYGVNTVKDIELSLKRFKQNDIEITGVILNGIDAKSDDYNYVYEY
                                             YNYVYEY
© 1998-2019