BYKdb

Annotate results for A0A142HHS5

A0A142HHS5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A142HHS5
DOMAINtad39/277DNFDLSTLVLVARRSLPWVIFLLTLGITSSWLYMRYTKPIYEATSILKIDDHSDASALGL
GMAMGGAENNQASQLAGEVELIKSGLTYKRLKQTVPLDINYYTQGTVLETELFGNCPYRV
TYVISDPAYYNHKFDVEYIDAKHYRLNVTVGNAKLGGNYEFGQLVKLPGISLRLLSASSP
AELDAIYHFVIVDDNTINSYLDHNLKAEVLNPIANTIQISFLDNNRFKAQRIVNALDTV
DOMAINcd619/807TSTISGEGKTFVTVNLGGIIALSGQRVVILDLDMRKPKVNLAFDAENVRGISTILIDRHT
VAECIQHTSIESLDFISAGPTPPNPSELILNPRFDLMIQELYRTYDVILIDTPPVGLVTD
GILIMRKADVPIYIVRANYSRKTFLKNMNRLMRNNQFTRMTTILNDAKAQGSYGYGYGYG
YGYGYGYGT
SITEWalker A626/628GKT
SITEWalker A'646/653VILDLDMR
SITEWalker B726/732ILIDTPP
SITE-720/-757YRTYDVILIDTPPVGLVTDGILIMRKADVPIYIVRANY
SITEY Cluster791/813YGYGYGYGYGYGYGYGTKGMGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASTENAELEELIRRASTGGEAAPPTGASFAEEDTEDGDNFDLSTLVLVARRSLPWVIFLLTLGITSSWLYMRYTKPIYE
                                      DNFDLSTLVLVARRSLPWVIFLLTLGITSSWLYMRYTKPIYE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATSILKIDDHSDASALGLGMAMGGAENNQASQLAGEVELIKSGLTYKRLKQTVPLDINYYTQGTVLETELFGNCPYRVTY
ATSILKIDDHSDASALGLGMAMGGAENNQASQLAGEVELIKSGLTYKRLKQTVPLDINYYTQGTVLETELFGNCPYRVTY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VISDPAYYNHKFDVEYIDAKHYRLNVTVGNAKLGGNYEFGQLVKLPGISLRLLSASSPAELDAIYHFVIVDDNTINSYLD
VISDPAYYNHKFDVEYIDAKHYRLNVTVGNAKLGGNYEFGQLVKLPGISLRLLSASSPAELDAIYHFVIVDDNTINSYLD

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HNLKAEVLNPIANTIQISFLDNNRFKAQRIVNALDTVYRDVKLAYKQETTENSLAYLDKQLEENGQNLAKAEDNLKIFVQ
HNLKAEVLNPIANTIQISFLDNNRFKAQRIVNALDTV                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QNGTYDAKGELGTITNKLEKIEEDRFKLEQKLTLLADVSQRAAAERLTPSDEVTVDQTIPGLALLEDPALSQQLNNLNAL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQNLRRIRRSYQDRLEAVQGPLAQLKFAQATLQHQLVQAQKQLRGQIALLDTQQGKLSNELQLIPGKETELERLKRPLGL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YGNSYQMLLEKKVEYNIKNAGTTADFQILSPAFAPEEPISPKKLLVYAIGLAGGLILGLGLIGTRYLMHNTITSVNELER


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTKASVLGVIPTYDKEQLNISRLIVDKNPKSSVSEAIRSIRTNLDFISPSNKKRLISVTSTISGEGKTFVTVNLGGIIAL
                                                          TSTISGEGKTFVTVNLGGIIAL
                                                                 GKT            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGQRVVILDLDMRKPKVNLAFDAENVRGISTILIDRHTVAECIQHTSIESLDFISAGPTPPNPSELILNPRFDLMIQELY
SGQRVVILDLDMRKPKVNLAFDAENVRGISTILIDRHTVAECIQHTSIESLDFISAGPTPPNPSELILNPRFDLMIQELY
     VILDLDMR                                                                   
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTYDVILIDTPPVGLVTDGILIMRKADVPIYIVRANYSRKTFLKNMNRLMRNNQFTRMTTILNDAKAQGSYGYGYGYGYG
RTYDVILIDTPPVGLVTDGILIMRKADVPIYIVRANYSRKTFLKNMNRLMRNNQFTRMTTILNDAKAQGSYGYGYGYGYG
     ILIDTPP                                                          YGYGYGYGYG
       810       820       830 
....:....|....:....|....:....|.
YGYGYGTKGMGYYDETEQKPTLGKRIKSLFS
YGYGYGT                        
YGYGYGTKGMGYY                  

© 1998-2019