BYKdb

Annotate results for A0A142W0R3

A0A142W0R3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A142W0R3
DOMAINcd454/643TSTRPAEGKSSSALSLASVFGQTGKKVMLIDADIRSPSLNELLDVDNRNGLSNYLTGFDK
VSELIASSPEFGFDYILAGPMPPNAAELFSSSRLSELVELLLRDYDHVILDAPPVLGLAD
APLLARPVEGVIFTIDASSSSARAIKSALNRLRQTDAQIFGALVTKVGRRNEIYGYGYGY
GYGYGYGYGY
SITEWalker A461/463GKS
SITEWalker A'481/488MLIDADIR
SITEWalker B561/567VILDAPP
SITEY Cluster627/645YGYGYGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
METDVEGAREKTISNEIAFFNTQYSLLESRSLAARTVRAGNLLNDKDFLAQYDLTGGEEGTPNSAQRARMAERAEKILLD


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVSIEPVRQSSLVDVSFSTPSATLSAKLTNLWVQQFVAANLDRRFSATSDARRFLEQRIGSLRRNLEDSERELITYAANN


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIITLETRSDPGTGRTIGDRTLVAADVEKISTALSVARDARIAAESQLSSSVSSTDLSSNAAVSALRQRRAELMADLARL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKIFGEEYPEIVAKKEQLAALNQSVSTETQRSRALNQESYASALKREKELQAELDRLTGKYRDQQRRSIEYAILQREVDT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRQLYDGLLQRYKEIGAAGVGTNNIAVVDTATPSPGPSSPKLILNVALALIAGFGLAGALVFLLEQLDQSIRDPSEVSDR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGLPLLGSIPKVDADTFEELLLDKKSMIYEAYFAAQTNLTFLTNHGAPRSFMLTSTRPAEGKSSSALSLASVFGQTGKKV
                                                     TSTRPAEGKSSSALSLASVFGQTGKKV
                                                            GKS                 
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIDADIRSPSLNELLDVDNRNGLSNYLTGFDKVSELIASSPEFGFDYILAGPMPPNAAELFSSSRLSELVELLLRDYDH
MLIDADIRSPSLNELLDVDNRNGLSNYLTGFDKVSELIASSPEFGFDYILAGPMPPNAAELFSSSRLSELVELLLRDYDH
MLIDADIR                                                                        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VILDAPPVLGLADAPLLARPVEGVIFTIDASSSSARAIKSALNRLRQTDAQIFGALVTKVGRRNEIYGYGYGYGYGYGYG
VILDAPPVLGLADAPLLARPVEGVIFTIDASSSSARAIKSALNRLRQTDAQIFGALVTKVGRRNEIYGYGYGYGYGYGYG
VILDAPP                                                           YGYGYGYGYGYGYG
       650     
....:....|....:
YGYGYGADKSRGNSE
YGY            
YGYGY          
© 1998-2019