BYKdb

Annotate results for A0A142WPR7

A0A142WPR7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A142WPR7
DOMAINtad15/163SDERTVNFLALTWRYLWLLILFGGVGTGAAYLHFLKQPPIYQSSSTVLVTGDRQQQANPL
GTESGFAQGITQTMPHQMLIGSPLVVRKAVETHDLRKHPAFAGESDPASRIVRGLNVLAD
SKTPDVIRMSFRDSDPEVCQVALEAVLDG
DOMAINcd545/733TSPNPGDGKSTLSGNLAISIAQTGKRVLLMDADFRRPRIHKLIGQNTSLGVSSVIAGTAE
LVDAIQDTPVENLAVLGCGPRPDNPAELLTGKRFDELLGVLREQYDFVIIDTPPLLAVTD
PSAVAPRVDAVIVTLRIAKRTRSEARRAMEVLGSVGANVLGVVVNGISSRKGYGYSGSGN
RGYAYGEGK
SITEWalker A552/554GKS
SITEWalker A'572/579LLMDADFR
SITEWalker B652/658VIIDTPP
SITEY Cluster717/738YGYSGSGNRGYAYGEGKAGVYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGIRGDFEDELSEKSDERTVNFLALTWRYLWLLILFGGVGTGAAYLHFLKQPPIYQSSSTVLVTGDRQQQANPLGTESGF
              SDERTVNFLALTWRYLWLLILFGGVGTGAAYLHFLKQPPIYQSSSTVLVTGDRQQQANPLGTESGF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQGITQTMPHQMLIGSPLVVRKAVETHDLRKHPAFAGESDPASRIVRGLNVLADSKTPDVIRMSFRDSDPEVCQVALEAV
AQGITQTMPHQMLIGSPLVVRKAVETHDLRKHPAFAGESDPASRIVRGLNVLADSKTPDVIRMSFRDSDPEVCQVALEAV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDGYRSYLGETHQTTSKDVAELIKEAKDVLLKQLETKEDEYHKFRQDAPLLFAKEEGAKNIHQERLAGIEQARSALLIAL
LDG                                                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HEKTAELDSLKNAMARGGNREALALIINANKESRENGLPQEKSPVTELFPLLLDEQMLLETLGPDHPKVTAVQKRIEITR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KYLTESLAEERKNAGENPMLKGGKRPDLVSLYLESLQHEVDVIQTKQKEMNLLFDQEKEAAKSLVAYEVRDESLRNEIAR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSKLFEGVVKRLDEISLVKGYGGYEMSVLSPPTEGFLTGPVMARYLALGAVAGIAVGYLLAYLLELNDRSFRDPEEVQTS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGLPVVGHIPVIELARADRRSNDAVHPSLVTFHRPKSRLAEAYRAVRTSLYFRTRGEPLKVIQVTSPNPGDGKSTLSGNL
                                                                TSPNPGDGKSTLSGNL
                                                                       GKS      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AISIAQTGKRVLLMDADFRRPRIHKLIGQNTSLGVSSVIAGTAELVDAIQDTPVENLAVLGCGPRPDNPAELLTGKRFDE
AISIAQTGKRVLLMDADFRRPRIHKLIGQNTSLGVSSVIAGTAELVDAIQDTPVENLAVLGCGPRPDNPAELLTGKRFDE
           LLMDADFR                                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLGVLREQYDFVIIDTPPLLAVTDPSAVAPRVDAVIVTLRIAKRTRSEARRAMEVLGSVGANVLGVVVNGISSRKGYGYS
LLGVLREQYDFVIIDTPPLLAVTDPSAVAPRVDAVIVTLRIAKRTRSEARRAMEVLGSVGANVLGVVVNGISSRKGYGYS
           VIIDTPP                                                          YGYS
       730       740       750  
....:....|....:....|....:....|..
GSGNRGYAYGEGKAGVYYSEEEHPASSLTSQS
GSGNRGYAYGEGK                   
GSGNRGYAYGEGKAGVYY              

© 1998-2019