BYKdb

Annotate results for A0A142XL75

A0A142XL75 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A142XL75
DOMAINcd527/716TSAVSGEGKTSLTGHLAISLARAGFRTLLVDGDLRSPTAHRVFDAPLAPGLCEILRGSTS
VLEAVRPTGIPGLSALTAGQWTLATRHALVGDRWRETKDQLKAEFDFVVVDTSPLLLVSD
TLLLAREADGVVVSVLMGVSQVALVDEAVTRLQAVRAKVTGVIANGVRHAAHAYTHGYGT
VDPVEHTPAP
SITEWalker A534/536GKT
SITEWalker A'554/561LLVDGDLR
SITEWalker B634/640VVVDTSP
SITEY Cluster700/704YTHGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTGRAILNAVKRRPFTLLGVALLAAGTGAAVWLFLPLPKATAATVFHVSAQAPSVLGQADGQANFVSYRASQIATIKRQR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLNNVIKVPAVENLAIVRKSPNPVAWLDHAIKIDAPANSEYMRVSLEGDDATESKIILEHLKTAYLADVDLRDNGAKWSR


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQKLEETKRGYRSELEKFHKQIDTIAAALGTKDEATLMTFDSFLRDELRLAQRDLQNARENLELAKPTPKIGINSLDEEG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AALTLPWDLGVVEIVPPLSPAELRAQIDAEIRQDAQLKQLAEAAASAKERLNKVKERYQEGERPPTVIKAEDDLKAAELR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDKHRDELGTTLAREVQKKHAQQEILRRAETRKQIRILEKRFALAKEKHDNILRKISQTNDYKIELSTIQFSIGQTEKLN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSLGETIERLKVELGAPSRVTCSEEPFIVTGIEGNRRLKYTVLAALAVFGIGFAGTIGLETRARRVTDTDDVTKALGVRL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGTVPAAGQESGKPGAPPPSLVEAIDATRTMLVHGTDEPDLRVLVVTSAVSGEGKTSLTGHLAISLARAGFRTLLVDGDL
                                              TSAVSGEGKTSLTGHLAISLARAGFRTLLVDGDL
                                                     GKT                 LLVDGDL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSPTAHRVFDAPLAPGLCEILRGSTSVLEAVRPTGIPGLSALTAGQWTLATRHALVGDRWRETKDQLKAEFDFVVVDTSP
RSPTAHRVFDAPLAPGLCEILRGSTSVLEAVRPTGIPGLSALTAGQWTLATRHALVGDRWRETKDQLKAEFDFVVVDTSP
R                                                                        VVVDTSP
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLLVSDTLLLAREADGVVVSVLMGVSQVALVDEAVTRLQAVRAKVTGVIANGVRHAAHAYTHGYGTVDPVEHTPAPAISA
LLLVSDTLLLAREADGVVVSVLMGVSQVALVDEAVTRLQAVRAKVTGVIANGVRHAAHAYTHGYGTVDPVEHTPAP    
                                                           YTHGY                
        
....:...
SPVTTERE


© 1998-2019