BYKdb

Annotate results for A0A142YJ13

A0A142YJ13 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A142YJ13
DOMAINtad56/204DAPDLIGLLRALRRRWRLAFLGGLSCASLAAAAAFYYLPSPKYTTSSLVHVAEKRPREIF
ETRESDVGYRTYQETQLILVKSRKVLEAAIAPPAIAALPIVRNSVDPIEWLSQQVQVEFP
RGSEILSISITANGPPSDLSMLVNSVTEA
DOMAINcd574/755TSATKGEGKTSLSCHLATSLARAGRRTLLIDCDLRKPSLHEIFEVPSEPGLCEVLSGEIG
WEGVVRETEVRDLSLILAGRCNPEAIELLPRQPLPDLIIALREQYEFIIVDSSPVLLVTD
TLIISQHIDAVLFSVLRDVSQLPQIRAAFDWLTSMGVRILGAVVSGVPAGSKHNYGSYPG
PK
SITEWalker A581/583GKT
SITEWalker A'601/608LLIDCDLR
SITEWalker B681/687IIVDSSP
SITEY Cluster748/751YGSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGTPGPNALHAEELPTVLPRREEAVAHGEMMIPVDRIAQRSVAVPSNLEPAPGTTDAPDLIGLLRALRRRWRLAFLGGLS
                                                       DAPDLIGLLRALRRRWRLAFLGGLS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CASLAAAAAFYYLPSPKYTTSSLVHVAEKRPREIFETRESDVGYRTYQETQLILVKSRKVLEAAIAPPAIAALPIVRNSV
CASLAAAAAFYYLPSPKYTTSSLVHVAEKRPREIFETRESDVGYRTYQETQLILVKSRKVLEAAIAPPAIAALPIVRNSV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DPIEWLSQQVQVEFPRGSEILSISITANGPPSDLSMLVNSVTEAYLSQIVEQDRLERVARFERLKGLFSDYQKDLSGKRA
DPIEWLSQQVQVEFPRGSEILSISITANGPPSDLSMLVNSVTEA                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KFKELAGSVGTSDKTASAVRQQMMVEHLGLARQELMRLQSDVRRSQARLNVLKSQPTVATTSNQDFASVEVREATSPDPK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMLIQDRISELRGRQARLSRNARKGNADPAAQALEREIKQLARTLESHRNTAQRALSAEPERFESSPVQDTRSREVEEYL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DILREQEKSLVQEIAGLESQMSSLNVKTMDVHWLDEEIEVASSTAKTVGAEVQSMTVEMQAPPRIRLIEKASIPTLSDPM


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRYKLSGAAGAGALVAFLGCLSLLEFRSRKVDMPDEVSDRLGLRIIGDLPRLDHARLDDPSGRDRDRLVQSIDAVRTMLL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVERQHSFQVVMVTSATKGEGKTSLSCHLATSLARAGRRTLLIDCDLRKPSLHEIFEVPSEPGLCEVLSGEIGWEGVVRE
             TSATKGEGKTSLSCHLATSLARAGRRTLLIDCDLRKPSLHEIFEVPSEPGLCEVLSGEIGWEGVVRE
                    GKT                 LLIDCDLR                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEVRDLSLILAGRCNPEAIELLPRQPLPDLIIALREQYEFIIVDSSPVLLVTDTLIISQHIDAVLFSVLRDVSQLPQIRA
TEVRDLSLILAGRCNPEAIELLPRQPLPDLIIALREQYEFIIVDSSPVLLVTDTLIISQHIDAVLFSVLRDVSQLPQIRA
                                        IIVDSSP                                 
       730       740       750     
....:....|....:....|....:....|....:
AFDWLTSMGVRILGAVVSGVPAGSKHNYGSYPGPK
AFDWLTSMGVRILGAVVSGVPAGSKHNYGSYPGPK
                           YGSY    

© 1998-2019