BYKdb

Annotate results for A0A142YNY8

A0A142YNY8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A142YNY8
DOMAINtad44/192MQVNPTSILRGLLRNWWKILGLWLIASLPLVYGIYTQVKPTYIAYSVIRIEPTQPELFGS
SSRGDGSSSIERIIETARAALISDRVLNGAIIDPQVSGLPFIKGSLSPRTELKERLAIVN
PRNTEFVHVSLESTNPEEAAAIVNAVVAS
DOMAINcd611/800SSAVGGEGKTTLAAQLAARCGHSGHSTLLIDADLRRGALSPLLDVADSKGLSDLLMNEDL
NPEDLAIPVQGGTFHLLSAGTPTSDTSRVFQGRAFGMLIARLRQLYDLIIIDSPPILPVP
DALIMGRWTDGVVLTSRYDVSRAPQVERARRQLDLAGIPVLGTVINGMRTSDSYYGRYSY
SRPGASTTDR
SITEWalker A618/620GKT
SITEWalker A'638/645LLIDADLR
SITEWalker B719/725IIIDSPP
SITEY Cluster784/790YYGRYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDTSDRHDSTLPARSHTPSSGVPARAATNFGGGSRELAVGASTMQVNPTSILRGLLRNWWKILGLWLIASLPLVYGIYTQ
                                           MQVNPTSILRGLLRNWWKILGLWLIASLPLVYGIYTQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKPTYIAYSVIRIEPTQPELFGSSSRGDGSSSIERIIETARAALISDRVLNGAIIDPQVSGLPFIKGSLSPRTELKERLA
VKPTYIAYSVIRIEPTQPELFGSSSRGDGSSSIERIIETARAALISDRVLNGAIIDPQVSGLPFIKGSLSPRTELKERLA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVNPRNTEFVHVSLESTNPEEAAAIVNAVVASYLQAQNELTEGADGLMKKSLEDYLKKMIDDKKEKVKELSTLMSKGKVD
IVNPRNTEFVHVSLESTNPEEAAAIVNAVVAS                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQSLTPNQASQANTAGPAAPADGTVQDSSKARNLGDVSIEQYRKWKDRLLETQVDLFQAKALLEQRTADYQNGAEIEQLE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGLRPSEEELTERIQAAFLADPAIADLRDEILTVRDRLSHVVSNARKGNDPSKRAHEARLKQLEGQHADFWAQRYPEIRA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QILAELEGRPTPTNPVRDESIKSIPELRADVEALERERKAITEALAQAELETKESNSETYTARYLQAEIDSMTHDQQIVH


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRLEDLKFRTDRDMVRVSLYDRAAVPRVPSSSKRIKLMAAAPMGIMALVLGIFSLLEVKAERVGDPDQLSTRVQSEVYSL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPIPMSRSPRRLGAPGDDDQIERFIQRLDHLRFAVCGDHPEVGLGRCVLISSAVGGEGKTTLAAQLAARCGHSGHSTLLI
                                                  SSAVGGEGKTTLAAQLAARCGHSGHSTLLI
                                                         GKT                 LLI
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRRGALSPLLDVADSKGLSDLLMNEDLNPEDLAIPVQGGTFHLLSAGTPTSDTSRVFQGRAFGMLIARLRQLYDLII
DADLRRGALSPLLDVADSKGLSDLLMNEDLNPEDLAIPVQGGTFHLLSAGTPTSDTSRVFQGRAFGMLIARLRQLYDLII
DADLR                                                                         II
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDSPPILPVPDALIMGRWTDGVVLTSRYDVSRAPQVERARRQLDLAGIPVLGTVINGMRTSDSYYGRYSYSRPGASTTDR
IDSPPILPVPDALIMGRWTDGVVLTSRYDVSRAPQVERARRQLDLAGIPVLGTVINGMRTSDSYYGRYSYSRPGASTTDR
IDSPP                                                          YYGRYSY          
       810
....:....|
ERPADATSAG


© 1998-2019