BYKdb

Annotate results for A0A142Z1P6

A0A142Z1P6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A142Z1P6
DOMAINtad17/271EEFILGDLLRVIAEDVWWLVGTVLVILAVGGLYCVFAKPVYVANALIKIEQANDSAPALM
QLSSVASAMTPLPADAEITIMQSRDVLRNVVEKFKFDITVEPKKIPIFGRLASSLATPGR
PANPWFGLTSYAWGGEVADVRSLEVPPVLEGERLILTSRPGGRYDLHDPDGNLLLRGTVG
KTSSGNGVTLFVNQLVARPETQFLVVRINDVDAVSGLQKFIAVQEQGKLTGLVDVSMESD
DPAFAAEVTNDLAQT
DOMAINcd549/735TGPVAGVGKSFLTVNLAVLLANSGKQVLMIDADMRKGALERYVGGAADGGLAELLAGGIP
VEEAIRQTRFDGLDFISCGKRPSNPAELLMSSRFAQCLHELEMLYDVILIDTPPVLAVTD
ASLVGEHAGASFLVLRSGMHRPIEIADAIKRLKVAGVDLKGGIFNGMPPSRRYGYGVVHR
YLTTDTS
SITEWalker A556/558GKS
SITEWalker A'576/583LMIDADMR
SITEWalker B656/662ILIDTPP
SITEY Cluster721/729YGYGVVHRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKNNGVMNSNARHDAEEEFILGDLLRVIAEDVWWLVGTVLVILAVGGLYCVFAKPVYVANALIKIEQANDSAPALMQLSS
                EEFILGDLLRVIAEDVWWLVGTVLVILAVGGLYCVFAKPVYVANALIKIEQANDSAPALMQLSS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VASAMTPLPADAEITIMQSRDVLRNVVEKFKFDITVEPKKIPIFGRLASSLATPGRPANPWFGLTSYAWGGEVADVRSLE
VASAMTPLPADAEITIMQSRDVLRNVVEKFKFDITVEPKKIPIFGRLASSLATPGRPANPWFGLTSYAWGGEVADVRSLE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPPVLEGERLILTSRPGGRYDLHDPDGNLLLRGTVGKTSSGNGVTLFVNQLVARPETQFLVVRINDVDAVSGLQKFIAVQ
VPPVLEGERLILTSRPGGRYDLHDPDGNLLLRGTVGKTSSGNGVTLFVNQLVARPETQFLVVRINDVDAVSGLQKFIAVQ

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQGKLTGLVDVSMESDDPAFAAEVTNDLAQTYLRRHVQSKQVNAENMLSFLKTEEPRLKAELDRAEIALAQYQRQSGSIT
EQGKLTGLVDVSMESDDPAFAAEVTNDLAQT                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGEEAKVYLAGSVEYEQQMSAMRLQLAALQERFGDDHPLIKATREQIGQLTAQRERYEARFRNLPEAEVRAVQLQRDAKV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAEIYELVLTREQELSVQKAGTGGNAQIVDMAIRPGTPVKPKKLLIMSAATMLGLILGVTVILARRRLFGGIEDPEAIER


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFQLRICGMVPLSDQYMQTGGRYVTGKGWPHSVLAHASPADACVESLRSLRTSMQFTMLDSRNRIVMLTGPVAGVGKSFL
                                                                    TGPVAGVGKSFL
                                                                           GKS  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVNLAVLLANSGKQVLMIDADMRKGALERYVGGAADGGLAELLAGGIPVEEAIRQTRFDGLDFISCGKRPSNPAELLMSS
TVNLAVLLANSGKQVLMIDADMRKGALERYVGGAADGGLAELLAGGIPVEEAIRQTRFDGLDFISCGKRPSNPAELLMSS
               LMIDADMR                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFAQCLHELEMLYDVILIDTPPVLAVTDASLVGEHAGASFLVLRSGMHRPIEIADAIKRLKVAGVDLKGGIFNGMPPSRR
RFAQCLHELEMLYDVILIDTPPVLAVTDASLVGEHAGASFLVLRSGMHRPIEIADAIKRLKVAGVDLKGGIFNGMPPSRR
               ILIDTPP                                                          
       730       
....:....|....:..
YGYGVVHRYLTTDTSTV
YGYGVVHRYLTTDTS  
YGYGVVHRY        

© 1998-2019