BYKdb

Annotate results for A0A143BIC3

A0A143BIC3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143BIC3
DOMAINtad39/262KGPSLGRYLAAINRFKWLIMLLGIVGAGAGYMATTFIEPEFEVRATILLEQGTGISNGGQ
SRGPIQADELLQASGWQDLLRSFAIADPVVNSLALFVTPSAAGDSTLFRSFRVSEQVPLR
PGAYILKLTGQTYTLETSGGLQVEQGAVGDSVGTRVGFMWQPTSQALAGRKDVGFNVQTP
REASIALIKKLKMNLANGSSFLFLNLTGNDAPRTAATLNAWVEQ
DOMAINcd607/795TSPGPNDGKSLISSNLALSFAESGARTLLIDGDIRRGELAKTFQITSKPGLVEYLDGTAL
IAEVLHPVQSHPNLTVMPGGARRRRAPELLATPRLNQLINQMAAEYDVVIVDSPPLGAGF
DAYALATATGNMALVMRAGVTDRKMAAAKMQVVDTLPVRVMGAVLNGIKMTGAYQYYSYY
QDYAATDEE
SITEWalker A614/616GKS
SITEWalker A'634/641LLIDGDIR
SITEWalker B715/721VIVDSPP
SITEY Cluster780/789YQYYSYYQDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSGQQIQPVSPRDVALEPYQDGAPPADWGGGQEAAPEPKGPSLGRYLAAINRFKWLIMLLGIVGAGAGYMATTFIEPEFE
                                      KGPSLGRYLAAINRFKWLIMLLGIVGAGAGYMATTFIEPEFE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRATILLEQGTGISNGGQSRGPIQADELLQASGWQDLLRSFAIADPVVNSLALFVTPSAAGDSTLFRSFRVSEQVPLRPG
VRATILLEQGTGISNGGQSRGPIQADELLQASGWQDLLRSFAIADPVVNSLALFVTPSAAGDSTLFRSFRVSEQVPLRPG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYILKLTGQTYTLETSGGLQVEQGAVGDSVGTRVGFMWQPTSQALAGRKDVGFNVQTPREASIALIKKLKMNLANGSSFL
AYILKLTGQTYTLETSGGLQVEQGAVGDSVGTRVGFMWQPTSQALAGRKDVGFNVQTPREASIALIKKLKMNLANGSSFL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FLNLTGNDAPRTAATLNAWVEQFVVVATALKKKNVTSVAAILEGQREFAAKSLNEAEGALESFRVRTVTEPTERQTITPG
FLNLTGNDAPRTAATLNAWVEQ                                                          

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IELTTNPVFDNYFRDKVLADGYQRDREALERILNAGKQGAPITREAVLSVPSVNTDPAAENLRKVLAEQADREFNLRRLR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESYTDEYQKVKDEQAALQTLRTVSVPGALDAYLGQLQLREKALVATIDRSSKDLRNIPARTIEEQRLKRQVEVSDAMYRN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNLKAAEAKLAEAATIPDVSILDPAVAPLRPTKNTAPVIIFAAVAAMLGLGVVLAILLDQVDKRFRYPEQATDDLGLFVL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVVPVIHSKGKRGKTDEAAQVVESFRTIRMNVRYAADPSRPLTMTITSPGPNDGKSLISSNLALSFAESGARTLLIDGDI
                                              TSPGPNDGKSLISSNLALSFAESGARTLLIDGDI
                                                     GKS                 LLIDGDI
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRGELAKTFQITSKPGLVEYLDGTALIAEVLHPVQSHPNLTVMPGGARRRRAPELLATPRLNQLINQMAAEYDVVIVDSP
RRGELAKTFQITSKPGLVEYLDGTALIAEVLHPVQSHPNLTVMPGGARRRRAPELLATPRLNQLINQMAAEYDVVIVDSP
R                                                                         VIVDSP
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLGAGFDAYALATATGNMALVMRAGVTDRKMAAAKMQVVDTLPVRVMGAVLNGIKMTGAYQYYSYYQDYAATDEEPVARI
PLGAGFDAYALATATGNMALVMRAGVTDRKMAAAKMQVVDTLPVRVMGAVLNGIKMTGAYQYYSYYQDYAATDEE     
P                                                          YQYYSYYQDY           
       810      
....:....|....:.
TDGTRGDGEMKQGGRS


© 1998-2019